DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk19 and Gr59e

DIOPT Version :9

Sequence 1:NP_651708.2 Gene:ppk19 / 43489 FlyBaseID:FBgn0039679 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:346 Identity:61/346 - (17%)
Similarity:109/346 - (31%) Gaps:145/346 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIPRPRPGLLRFRNNPRGIKFREKLCNSFAHSNIHGMQHVFGEQHLWQ----RCL---------- 59
            |.|..|.|:||:                     :|.:..:|...::|.    :||          
  Fly    19 VYPSGRVGVLRW---------------------LHTLWSLFLLMYIWTGSIVKCLEFTVEIPTIE 62

  Fly    60 -------------WLAIVL-----------GA------VITGF--SLYTVLMHRHSEQLLVSLIE 92
                         .:||::           ||      :|||.  ....::..||.::.| .|:.
  Fly    63 KLLYLMEFPGNMATIAILVYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHGQRTL-HLMA 126

  Fly    93 TTQLPVYH--------IDFPAVAVCPWN-----------------------HFNW-----QRAPS 121
            ||.  |:|        :::.......|:                       ||.|     .|...
  Fly   127 TTL--VFHGLCVLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLWLVMDQMRMCL 189

  Fly   122 AFIRFLPRHPNAELR------ETFRQLLAS-------MDIMNFSNFNRIRILTKRNLTGISYLKM 173
            ..::.|.|.|....:      ..|..|:.:       ::.|.:: .|.|..:..:.|.......:
  Fly   190 KELKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYT-CNLIEQVHSQFLLRFGLYLV 253

  Fly   174 TDLMNFMTYRCDELFVADSCVFDETP---------YDCC-----------KLFVREQTVKGQ--- 215
            .:|:|.:...|.||::..:  |.|||         |...           .|.|.||.::.:   
  Fly   254 LNLLNSLVSICVELYLIFN--FFETPLWEESVLLVYRLLWLAMHGGRIWFILSVNEQILEQKCNL 316

  Fly   216 CLVFNSMISENSRKKHLINQF 236
            |.:.|.:...:||.:..||:|
  Fly   317 CQLLNELEVCSSRLQRTINRF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk19NP_651708.2 ASC 39..489 CDD:279230 55/316 (17%)
AceK 116..>139 CDD:295079 5/33 (15%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 61/346 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.