DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk19 and egas-3

DIOPT Version :9

Sequence 1:NP_651708.2 Gene:ppk19 / 43489 FlyBaseID:FBgn0039679 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:303 Identity:56/303 - (18%)
Similarity:110/303 - (36%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VKGQCLVFNSMISENSRKKHLINQFYPHKLSTAGEDSGLKFTINASYSFM-NNIDALTPF----G 271
            |.|.|..||..           ::.:.:.:...|...|::       :|| ...|...|:    .
 Worm   647 VLGNCFTFNHR-----------DRNFTYLMRRPGRHGGIQ-------AFMKTRQDEYAPWYDTAA 693

  Fly   272 MNLMI--KEPRQWSNEMMYHLYPDTENFVAVHPLVTETSPNTYEMSPKKRRCYFDDEKNPTFQNT 334
            :|:.|  ::...:|..:.|:..|:.::.:.:...........|....||.    .:.||..:.. 
 Worm   694 INVFIHNRDDYVFSESVRYNAQPNAQSTINIFMTRYTRLGGNYGKCIKKP----SEVKNYYYPG- 753

  Fly   335 SLTYNRENCLVVCLHLVVWKTCQCSLPAFLPPIDGVPECGINDAQCLGNNSDIFTYVKMGDQEKY 399
              .|..:.||..|....:.:.|.|..|.: |.......|.:::..|:...|:     ..||...:
 Worm   754 --AYTTDGCLRTCYQDRMKEECNCMDPRY-PQAPNSTSCQLSERSCVTEASE-----AAGDPSTW 810

  Fly   400 INDSRQGHFCDCPDNCNSRLYEMS---LNVRKLDYPKNSTDQLIKAQVYYGQRVMTKIITKLKYT 461
            .:       |.||..|:::.|.::   .|...|......:..:...|..|..::|..||    ..
 Worm   811 SS-------CVCPLPCSNQEYSVTWSKANFVNLPITCEKSSDVATCQKQYKDQLMVSII----LP 864

  Fly   462 NID--------------LLANFGGIISLYIGASVMSFIELLFV 490
            .:|              .|:..||.:.:.:|.:|::|||::|:
 Worm   865 QLDFKIYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVFL 907

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk19NP_651708.2 ASC 39..489 CDD:279230 55/300 (18%)
AceK 116..>139 CDD:295079
egas-3NP_507638.2 ASC <649..907 CDD:279230 54/299 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.