DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99a and Obp83a

DIOPT Version :9

Sequence 1:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:91 Identity:21/91 - (23%)
Similarity:39/91 - (42%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQ-QLVGNHA 92
            :.|.||::..|....::::...|...|.|.:||:.|.|                 |: ::|.::.
  Fly    71 FHDACVEKTGVTEAAIKEFSDGEIHEDEKLKCYMNCFF-----------------HEIEVVDDNG 118

  Fly    93 D-HNEAFHASLAACV-DKNEQGSNAC 116
            | |.|...|::...: ||..:.|..|
  Fly   119 DVHLEKLFATVPLSMRDKLMEMSKGC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 21/91 (23%)
Obp83aNP_001287190.1 PBP_GOBP 64..166 CDD:279703 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.