DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99a and Obp56h

DIOPT Version :9

Sequence 1:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001188979.1 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:61/134 - (45%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVAICVLIGLASADYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKWEYPNDAK--TQCYIKCVF 66
            |...|  |.||:...:.:...|......:|::...|....::::......:.||  .:||.||:.
  Fly     3 FTLFC--IALAAFLSMGQCNPDFRQIMQQCMETNQVTEADLKEFMASGMQSSAKENLKCYTKCLM 65

  Fly    67 TKWGLFDVQSG-FNVENIHQQL--VGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCLLK 128
            .|.|  .:.:| ||.:.:...|  |....|..:...:.:.||  |:.:|:|.|:.|::...| ||
  Fly    66 EKQG--HLTNGQFNAQAMLDTLKNVPQIKDKMDEISSGVNAC--KDIKGTNDCDTAFKVTMC-LK 125

  Fly   129 ENLA 132
            |:.|
  Fly   126 EHKA 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 26/105 (25%)
Obp56hNP_001188979.1 PhBP 26..128 CDD:214783 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.