DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99a and Obp47a

DIOPT Version :9

Sequence 1:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:137 Identity:35/137 - (25%)
Similarity:65/137 - (47%) Gaps:14/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVAICVLIGLASADYVVKN-RHDMLAYRDECVKELAVPVDLVEKYQKWEYPNDAKT-QCYIKCVF 66
            |..|.:.:||..||...|. ..:|:..   |..:..:.:..:.|.|:.::.:.::: ||:..|::
  Fly    21 FAKININLGLTVADESPKTITEEMIRL---CGDQTDISLRELNKLQREDFSDPSESVQCFTHCLY 82

  Fly    67 TKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCLLKENL 131
            .:.||  :..|..||   :.|.|..:|.:...:.....|  ...:|:|.||.|||...|  ::.|
  Fly    83 EQMGL--MHDGVFVE---RDLFGLLSDVSNTDYWPERQC--HAIRGNNKCETAYRIHQC--QQQL 138

  Fly   132 AQIQKSL 138
            .|.|::|
  Fly   139 KQQQQNL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 23/101 (23%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.