DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99a and Obp28a

DIOPT Version :9

Sequence 1:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_523505.1 Gene:Obp28a / 34031 FlyBaseID:FBgn0011283 Length:143 Species:Drosophila melanogaster


Alignment Length:131 Identity:32/131 - (24%)
Similarity:46/131 - (35%) Gaps:42/131 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVAICVLIGLA------SADYVVKNRHDMLAYRDECVKEL-AVPVDLVEKYQKWEYPNDAKT-- 58
            :.||| ||:|.|      ..:.:.|    ::...:.|:.|: |...||.|..:|    ..|.|  
  Fly     7 ILVAI-VLLGAALVRAFDEKEALAK----LMESAESCMPEVGATDADLQEMVKK----QPASTYA 62

  Fly    59 -QCYIKCVFTKWGLFDVQSGFNVENIHQ---QLVGNHA--------------------DHNEAFH 99
             :|...||....|:.|.....:.|..|:   |..||..                    ||.||..
  Fly    63 GKCLRACVMKNIGILDANGKLDTEAGHEKAKQYTGNDPAKLKIALEIGDTCAAITVPDDHCEAAE 127

  Fly   100 A 100
            |
  Fly   128 A 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 24/99 (24%)
Obp28aNP_523505.1 PhBP 35..134 CDD:214783 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.