powered by:
Protein Alignment Obp99a and Obp56c
DIOPT Version :9
Sequence 1: | NP_001287586.1 |
Gene: | Obp99a / 43488 |
FlyBaseID: | FBgn0039678 |
Length: | 142 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_995902.1 |
Gene: | Obp56c / 170882 |
FlyBaseID: | FBgn0046879 |
Length: | 245 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 28/69 - (40%) |
Gaps: | 11/69 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 QCYIKCVFTKWGLFDVQSGFNV--ENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYR 121
||::.|::....| ..:|| |...:..|.....|.: |.:..|.|. ||...||.||:
Fly 135 QCFVSCLYETLDL----DRYNVLLEEAFKNQVQTIIQHEK---AEIKECSDL--QGKTRCEAAYK 190
Fly 122 GATC 125
...|
Fly 191 LHLC 194
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Obp99a | NP_001287586.1 |
PhBP |
29..130 |
CDD:214783 |
19/69 (28%) |
Obp56c | NP_995902.1 |
PBP_GOBP |
<125..195 |
CDD:279703 |
19/69 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.