DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp99a and Obp83g

DIOPT Version :9

Sequence 1:NP_001287586.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_731043.1 Gene:Obp83g / 170878 FlyBaseID:FBgn0046875 Length:146 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:63/130 - (48%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIGLASADYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDV 74
            |:...:|.:::|:..|.....:||.::..||.|:.|||..:|:|...:|.|::||...|..||..
  Fly    17 LVAQTTAKFLLKDHADAEKAFEECREDYYVPDDIYEKYLNYEFPAHRRTSCFVKCFLEKLELFSE 81

  Fly    75 QSGFNVENIHQQLVGNHADHNEAFHASLAACVDKNEQGSNACEWAYRGATCLLKENLAQIQKSLA 139
            :.||:...:..|.....:.........|..|:|.||..|:.|.||.|..:|.|..|...::|..|
  Fly    82 KKGFDERAMIAQFTSKSSKDLSTVQHGLEKCIDHNEAESDVCTWANRVFSCWLPINRHVVRKVFA 146

  Fly   140  139
              Fly   147  146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp99aNP_001287586.1 PhBP 29..130 CDD:214783 32/100 (32%)
Obp83gNP_731043.1 PBP_GOBP 22..134 CDD:279703 34/111 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450208
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBJK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105360at50557
OrthoFinder 1 1.000 - - FOG0016808
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.