DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and SCNN1D

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001123885.2 Gene:SCNN1D / 6339 HGNCID:10601 Length:802 Species:Homo sapiens


Alignment Length:346 Identity:67/346 - (19%)
Similarity:119/346 - (34%) Gaps:108/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HFFTECQWRRKAMNCCDLFRPTKTFN----GFAFEFNSLVSSGRDETWPWSVASCGSYS--GLNV 212
            ||...|.:  ..::|  ..|..:||:    |..:..:.:          |:....|...  ||.:
Human   422 HFVLSCSY--DGLDC--QARQFRTFHHPTYGSCYTVDGV----------WTAQRPGITHGVGLVL 472

  Fly   213 KIKRQQGLYTLNTMG---VIVH--EPTQLLG---MSIDYSSEDRIVVPVEPLHFT----AELDVR 265
            ::::|..|..|:|:.   |:||  ..|..||   .|:...:|..|.:..:.:|..    ......
Human   473 RVEQQPHLPLLSTLAGIRVMVHGRNHTPFLGHHSFSVRPGTEATISIREDEVHRLGSPYGHCTAG 537

  Fly   266 ARPVQMRRCYFENEIPTGKSRSECIYKCHVNYIISKCNCSLEL-PVKATQDEDNIAAAKESNGRR 329
            ...|::...:     .|..:|..|:..|....::..|:|...| |:.|              |..
Human   538 GEGVEVELLH-----NTSYTRQACLVSCFQQLMVETCSCGYYLHPLPA--------------GAE 583

  Fly   330 IC-GVKDLA---CF-------NQHRLSLFSMSNIIEESRDNVFSTVDCGCFPQCGHTQYHTSTYT 383
            .| ..:..|   ||       ..|||...|.                  |...|..:.:..||.|
Human   584 YCSSARHPAWGHCFYRLYQDLETHRLPCTSR------------------CPRPCRESAFKLSTGT 630

  Fly   384 EKM--------------------SAHTNLAAAIEIDVYFQEETLFSYRSMLR---FTLIDLMVSY 425
            .:.                    .:|...::..:|::.:||   .:|||:..   :::..|:.:.
Human   631 SRWPSAKSAGWTLATLGEQGLPHQSHRQRSSLAKINIVYQE---LNYRSVEEAPVYSVPQLLSAM 692

  Fly   426 GGIAGLIMGISVLGCINELLD 446
            |.:..|..|.|||..: |||:
Human   693 GSLCSLWFGASVLSLL-ELLE 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 66/344 (19%)
SCNN1DNP_001123885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..211
ENaC 219..784 CDD:273304 67/346 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.