DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and SCNN1B

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_016879014.1 Gene:SCNN1B / 6338 HGNCID:10600 Length:659 Species:Homo sapiens


Alignment Length:512 Identity:100/512 - (19%)
Similarity:165/512 - (32%) Gaps:213/512 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IDFPAVTII---PINLSILK------------------AEKLSKA---YNLVQSVVWQTP----- 118
            :|||||||.   |...|.:|                  |.:||.|   .||..|:...||     
Human   109 MDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLID 173

  Fly   119 ------------------------------------MSARL--------TDENFTEFSE-LENWN 138
                                                |:.||        |..|||..:: |..|.
Human   174 ERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWY 238

  Fly   139 -AQSWGIY------QALQMN---------CQHFFTECQWRRKAMNCCDLFRP----TKTFN---- 179
             .|:..|:      :.::|:         |......|.:|    |...:|.|    ...||    
Human   239 ILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYR----NFTSIFYPHYGNCYIFNWGMT 299

  Fly   180 ---------GFAFEFNSLVSSGRDETWPWSVASCG---------SYSGLNVKIKRQQGLYTLN-- 224
                     |..|....::..|:::..|:..::.|         ||..:     |.:|:|.::  
Human   300 EKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFI-----RDEGIYAMSGT 359

  Fly   225 --TMGVIVHEPTQLLGMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRRCYFENEIPTGKSRS 287
              ::||:| :..|.:|......:.:...|||:                    .|.::..|..|..
Human   360 ETSIGVLV-DKLQRMGEPYSPCTVNGSEVPVQ--------------------NFYSDYNTTYSIQ 403

  Fly   288 ECIYKCHVNYIISKCNCS---LELPVKATQDEDNIAAAKESNGRRICGVKDLA----CFNQHRLS 345
            .|:..|..:::|..|||.   ..||                .|.:.|..:|..    |::..::|
Human   404 ACLRSCFQDHMIRNCNCGHYLYPLP----------------RGEKYCNNRDFPDWAHCYSDLQMS 452

  Fly   346 LFSMSNIIEESRDNVFSTVDCGCFPQCGHTQY-------------------HTSTYTEKMSAHTN 391
            :......|..            |...|..|||                   |..:.....|.:..
Human   453 VAQRETCIGM------------CKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNIT 505

  Fly   392 LA--AAIEIDVYFQEETLFSYRSM---LRFTLIDLMVSYGGIAGLIMGISVLGCINE 443
            |:  ..:::::||||   |:||::   ....::.|:.:.||..|..||.||| |:.|
Human   506 LSRKGIVKLNIYFQE---FNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVL-CLIE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 100/512 (20%)
SCNN1BXP_016879014.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.