DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and SCNN1A

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001153048.1 Gene:SCNN1A / 6337 HGNCID:10599 Length:728 Species:Homo sapiens


Alignment Length:343 Identity:61/343 - (17%)
Similarity:117/343 - (34%) Gaps:107/343 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVSSGRDETWPWSVASCGSYSGLNVKIKRQQ 218
            :|...|::.:.:.|..:.........|..:.||...:|..     |..:..|..:||::.::.:|
Human   336 NFIFACRFNQVSCNQANYSHFHHPMYGNCYTFNDKNNSNL-----WMSSMPGINNGLSLMLRAEQ 395

  Fly   219 G-----LYTLNTMGVIVH---EPTQL----------LGMSIDYSSE--DRI------------VV 251
            .     |.|:....|:||   ||..:          :..||....|  ||:            .|
Human   396 NDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV 460

  Fly   252 PVEPLHFTAELDVRARPVQMRRCYFENEIPTGKSRSECIYKCHVNYIISKCNCSLELPVKATQDE 316
            |||.|:                       |:..::..||:.|....:|.:|.|:. :.....|:.
Human   461 PVENLY-----------------------PSKYTQQVCIHSCFQESMIKECGCAY-IFYPRPQNV 501

  Fly   317 DNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGCFPQC--------- 372
            :.....|.|:..        .|:.:.::.               ||:...|||.:|         
Human   502 EYCDYRKHSSWG--------YCYYKLQVD---------------FSSDHLGCFTKCRKPCSVTSY 543

  Fly   373 ----GHTQYHTSTYTE----KMSAHTNLA------AAIEIDVYFQEETLFSYRSMLRFTLIDLMV 423
                |::::.:.|..|    .:|...|..      ...:::::|:|....:.......|::.|:.
Human   544 QLSAGYSRWPSVTSQEWVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLS 608

  Fly   424 SYGGIAGLIMGISVLGCI 441
            :.|....|..|.|||..:
Human   609 NLGSQWSLWFGSSVLSVV 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 61/343 (18%)
SCNN1ANP_001153048.1 ENaC 113..706 CDD:273304 61/343 (18%)
deg-1 121..631 CDD:273309 61/343 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.