DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ASIC4

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_061144.4 Gene:ASIC4 / 55515 HGNCID:21263 Length:539 Species:Homo sapiens


Alignment Length:465 Identity:94/465 - (20%)
Similarity:159/465 - (34%) Gaps:147/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VSILSSERYFYYWVQTSIER---TDMHVSEID---------FPAVTIIPINLSILKAEKLSKA-- 106
            :::|:|...|.|.. ..:.|   |..|:..:|         |||||:  .|::..:...||.|  
Human    72 LALLTSLAAFLYQA-AGLARGYLTRPHLVAMDPAAPAPVAGFPAVTL--CNINRFRHSALSDADI 133

  Fly   107 YNLVQSVVWQTPMSA---RLTDENFTEFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAMNC 168
            ::|. ::....|...   |.....:.|...::..|.....:...|: :|......|    .|.| 
Human   134 FHLA-NLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQLADMLK-SCNFSGHHC----SASN- 191

  Fly   169 CDLFRPTKTFNGFAFEFN-----SLVS------SG--------RDETWP-WSVASCGSY-SGLNV 212
               |....|..|..:.||     ||.|      ||        ::|..| |...:..|: :|:.|
Human   192 ---FSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQEEYLPIWRETNETSFEAGIRV 253

  Fly   213 KIKRQQGLYTLNTMGVIVHEPTQLLGMSIDYSS-----EDRIVVPVEPL-HFTAELDVRARPVQM 271
            :|..|:....::.:|         .|:|..:.:     |.|:....:|. :..||.::|...:|.
Human   254 QIHSQEEPPYIHQLG---------FGVSPGFQTFVSCQEQRLTYLPQPWGNCRAESELREPELQG 309

  Fly   272 RRCYFENEIPTGKSRSECIYKCHVNYIISKCNCSL-ELPVKATQDEDNIAAAKESNGRRICGVKD 335
            ...|         |.|.|..:|....::.:|:|.: .:|...|                ||    
Human   310 YSAY---------SVSACRLRCEKEAVLQRCHCRMVHMPGNET----------------IC---- 345

  Fly   336 LACFNQHRLSLFSMSNIIEESRDNVFSTV------DCGCFPQCGHTQY----------------- 377
                         ..||..|..|:...::      .|.|...|..|:|                 
Human   346 -------------PPNIYIECADHTLDSLGGGPEGPCFCPTPCNLTRYGKEISMVRIPNRGSARY 397

  Fly   378 ------HTSTYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGIS 436
                  ...||..:     |.   :.:||:|:..|..:......:.|..|:...||..||.:|.|
Human   398 LARKYNRNETYIRE-----NF---LVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGAS 454

  Fly   437 VLGCINELLD 446
            :|..: |:||
Human   455 ILTLL-EILD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 92/463 (20%)
ASIC4NP_061144.4 ASC 40..488 CDD:413546 94/465 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.