DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ASIC1

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_064423.2 Gene:ASIC1 / 41 HGNCID:100 Length:574 Species:Homo sapiens


Alignment Length:495 Identity:101/495 - (20%)
Similarity:178/495 - (35%) Gaps:148/495 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GWASTRRYARIPLK-------IMAALATVYVSILSSER---YFYYWVQTSIERTDMHVSEIDFPA 87
            |.|....|.|:.||       .:.:||.:.  .:.:||   ||:|...|.::  ::..|::.|||
Human    29 GLAHIFSYERLSLKRALWALCFLGSLAVLL--CVCTERVQYYFHYHHVTKLD--EVAASQLTFPA 89

  Fly    88 VTIIPINLSILKAEKLSK--AYNLVQSVV-----WQTPMSARLTDE----------NFTEFSELE 135
            ||:  .||:..:..::||  .|:..:.:.     ::.| ..::.||          ||..|.. :
Human    90 VTL--CNLNEFRFSQVSKNDLYHAGELLALLNNRYEIP-DTQMADEKQLEILQDKANFRSFKP-K 150

  Fly   136 NWNAQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVSSGRDETWPWS 200
            .:|.:.:  |.....:.:.....|.:|.:..:..| |:...|..|..:.||    ||||......
Human   151 PFNMREF--YDRAGHDIRDMLLSCHFRGEVCSAED-FKVVFTRYGKCYTFN----SGRDGRPRLK 208

  Fly   201 VASCGSYSGLNVKIKRQQGLYTLNTMGVIVHEPTQLLGMSIDYSSEDRIVVPVEPLHFTAELDVR 265
            ....|:.:||.:.:..||..| |...|. ..|.:...|:.:...|:|      || .|..:|...
Human   209 TMKGGTGNGLEIMLDIQQDEY-LPVWGE-TDETSFEAGIKVQIHSQD------EP-PFIDQLGFG 264

  Fly   266 ARP--------VQMRRCYFENEIPTGK--------------SRSECIYKCHVNYIISKCNCSL-E 307
            ..|        .:.|..|......|.|              |.:.|...|...|::..|||.: .
Human   265 VAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVH 329

  Fly   308 LPVKA---TQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGCF 369
            :|..|   |.::     .||             |.:.      ::..::|:.::.      |.|.
Human   330 MPGDAPYCTPEQ-----YKE-------------CADP------ALDFLVEKDQEY------CVCE 364

  Fly   370 PQCGHTQYHTSTYTEKMSAHTN---LAA------------AIEIDVYFQEETLFSYRSMLRFTLI 419
            ..|..|:|.......|:.:..:   ||.            .:.:|::|:         :|.:..|
Human   365 MPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFE---------VLNYETI 420

  Fly   420 DLMVSYGGIAGLIMGISVLGCINELLDR---FACCRIPHG 456
            :...:|          .:.|.:.|||..   |:|    ||
Human   421 EQKKAY----------EIAGLLGELLMTPVPFSC----HG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 90/459 (20%)
ASIC1NP_064423.2 ENaC 19..556 CDD:273304 101/495 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.