DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and asic4a

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_999952.1 Gene:asic4a / 407668 ZFINID:ZDB-GENE-040513-5 Length:539 Species:Danio rerio


Alignment Length:514 Identity:103/514 - (20%)
Similarity:169/514 - (32%) Gaps:147/514 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EPSSEDNDDDHKESKKKLKKEGAGGWASTRRYARIPLKIMAALAT---------VYVS------- 57
            :...:.|.|..|||   |.:|....          |.|.:|..|:         ::||       
Zfish    15 DEKQKGNQDGDKES---LIEESCSP----------PTKDLAGFASASSLHGINHIFVSGRLGVRQ 66

  Fly    58 -------ILSSERYFYYWVQTSIERTD-MHVS--------EIDFPAVTIIPINLSILKAEKLSKA 106
                   ::|...:.|...:.:|...: .||:        |:.||||||..||.....|...:..
Zfish    67 TLWALAFLVSLALFLYQAAKCAISYLEHPHVTALNEEATPEMVFPAVTICNINRFRFSALTDADI 131

  Fly   107 YNLVQSVVWQTPMSARLT-----DENFTEFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAM 166
            |:|           |.||     :::..:.::||........|:.......:.....|.:  ...
Zfish   132 YHL-----------ANLTGLPPKNKDGHKPTDLEYPAPDMQDIFNRTGHQLEEMLKSCNF--SGQ 183

  Fly   167 NC-CDLFRPTKTFNGFAFEFNSLVSSGRDETWPWSVASCGSYSGLNVKIKRQQGLYTLNTMGVIV 230
            || .:.|....|..|..:.||...::.|      .....|..:||.:.:..||..|.  .:....
Zfish   184 NCSAEDFTVVYTRYGKCYTFNGNKTTSR------KTKQGGMGNGLEIMLDIQQDDYL--PIWKET 240

  Fly   231 HEPTQLLGMSIDYSSEDRIVVPVEP--LHFTAELDVRARP--------VQMRRCYFENEIPTGKS 285
            :|.:...|:.:...|:|      ||  :|   :|.....|        .:.|..|...  |.|..
Zfish   241 NETSLEAGIRVQIHSQD------EPPYIH---QLGFGVSPGFQTFVSCQEQRLTYLPQ--PWGNC 294

  Fly   286 R---------------SECIYKCHVNYIISKCNCSL-ELPVKATQDEDNIAAAKESNGRRICGVK 334
            |               |.|..:|....::.:|.|.: .:|..|                .||...
Zfish   295 RSTSEQMIPGYDTYSISACRLRCETLEVLRECKCRMVHMPGDA----------------NICTPS 343

  Fly   335 DLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGC-----------FPQCGHTQYHTSTYTEKMS- 387
            |:.|.:: .|:|...|     |.|..|....|..           .|..|..:|.:..|.:... 
Zfish   344 DIKCVDK-ALALLQKS-----SGDTCFCETPCNLTRYGKELSMVKIPSKGSARYLSRKYDKSEDY 402

  Fly   388 AHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINELLD 446
            ...|.   :.:|::|:.....:......:.:..|:...||..||.:|.||| .|.|:||
Zfish   403 IRDNF---LVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVL-TILEILD 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 92/474 (19%)
asic4aNP_999952.1 ASC 44..472 CDD:295594 93/472 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 474..494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.