DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and Gr59e

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:147 Identity:28/147 - (19%)
Similarity:47/147 - (31%) Gaps:65/147 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 WRRKAMNCCDLFRPTKTFNG---------FAFEFNSLVSSGRDETW-PWSVASCGSYSGLNVKIK 215
            ::|.......|...|..|:|         :.|||           | .||..|..:..||     
  Fly   114 YKRHGQRTLHLMATTLVFHGLCVLVDVVNYDFEF-----------WTTWSSNSVYNLPGL----- 162

  Fly   216 RQQGLYTLNTMGVIVHEPTQLLGMSIDYSSEDRIVVPVEPLHFT-AELDVRARPVQMRRCYFENE 279
                   :.::||:.:                     .:|:||. ..:|      |||.|..|.:
  Fly   163 -------MMSLGVLQY---------------------AQPVHFLWLVMD------QMRMCLKELK 193

  Fly   280 I----PTGKSRSECIYK 292
            :    |.|.::.:..|:
  Fly   194 LLQRPPQGSTKLDACYE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 28/147 (19%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.