DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ppk12

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster


Alignment Length:518 Identity:106/518 - (20%)
Similarity:180/518 - (34%) Gaps:156/518 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKKEGAGGWASTRRYARIPLKIMAALATVYVSILSSERYFYYWVQT----SIERTDMHVSEIDFP 86
            ||..|..|.:|..|...:...:.|.:.||:  ::|:  .:..|..|    .|......:.::.||
  Fly    38 LKFVGDSGLSSWERSFFLGSFVTALIITVH--LISN--IYVKWDSTPVIIGISPQATSILKVPFP 98

  Fly    87 AVTIIPIN----------------LSILKAEKLSKAYNLVQSVVWQTPMSARLTDENFT------ 129
            |:||..:|                .::||.        |.:|..|::..:    ||.|:      
  Fly    99 AITICNMNQVQRSLVANYREGSNESALLKL--------LCESDSWESSEA----DEEFSASNFVT 151

  Fly   130 ---EFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFN----- 186
               :.||..:.::||          |:.....|::.....||..||:...|..|....||     
  Fly   152 NNLKISEFVSNHSQS----------CERMLLFCRFSAVERNCSQLFQQILTDEGLCCVFNFQPPE 206

  Fly   187 -----------SLVSSGRDET-----------------WPWSVASCGSYSGLNVKIKRQQG-LYT 222
                       :|.:|...|:                 :|.:.:..|...|....:..:.| .|.
  Fly   207 YLYKPFANNNRNLTNSDGFESVMWDPESGYPEQLPPKFYPATASGTGITLGFTAVLDAEMGEYYC 271

  Fly   223 LNTMG----VIVHEPTQL-------LGMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRRCYF 276
            .:|.|    |..|.|.::       |..:|.|.:..||    |.:...|...:|:.....|:|.|
  Fly   272 SSTNGPGFKVYFHNPIEVPKVKEAGLISAIGYETNYRI----EMVRAEAVPAIRSISRDGRQCLF 332

  Fly   277 ENE-------IPTGKSRSECIYKCHVNYIISKCNCSLELPVKATQDEDNIAAAKESNGRRICGVK 334
            :||       |.|   |..|..:|...::...|:|   :|........|.:         ||.:.
  Fly   333 KNEKELIFYRIYT---RLNCENECLAAFLYDTCSC---IPFDHPLIYSNAS---------ICSMG 382

  Fly   335 DLACFNQHRLSLFSMSNIIEESRDNVFSTVDC--GCFPQCGHTQYHTSTYTEKMSAHT-NLAAAI 396
            |.:|..:            .:...|......|  .|.|.|....|..|.::..::::. .||.|:
  Fly   383 DTSCVRR------------AQRASNRPGWAKCRQQCLPSCFDLNYLASGFSFPLASNNFQLANAL 435

  Fly   397 --------------EIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINELL 445
                          .|:|||:|...:.........|.:.:.:.||:.||.||.||:. :.|:|
  Fly   436 VESFNKSYLSKNIAVINVYFRESVYYGNTKNAYVGLTEFLSNVGGVMGLFMGFSVIS-LAEIL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 100/497 (20%)
ppk12NP_611672.1 deg-1 28..499 CDD:273309 106/518 (20%)
ASC 29..499 CDD:279230 106/518 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.