DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ppk6

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_611461.3 Gene:ppk6 / 37286 FlyBaseID:FBgn0034489 Length:498 Species:Drosophila melanogaster


Alignment Length:501 Identity:99/501 - (19%)
Similarity:190/501 - (37%) Gaps:101/501 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WKPEPSSEDNDDDHKESKKK-----------------LKKEGAGGWASTR-------RYARIPLK 46
            | |.|..:::..|....:.|                 .:.:.:|.|...|       |:....:.
  Fly     7 W-PTPGKKNSKGDGSRKRGKDPSLIRTAILATFWEYTERTKVSGMWLMRRNRTYGLSRFIWSSVL 70

  Fly    47 IMAALATVYVSILSSERYFYYWVQTSIERTDMHVSEIDFPAVTIIP---INLS----ILKAEKLS 104
            :...|.::|:::|...:::.|.:..:|. .|:.::::.||.|||..   :|..    .:|..|:.
  Fly    71 LQLLLLSIYLTLLLWLKFYSYPILNTIS-NDLSITDVAFPGVTICSPKVVNSERVDRYVKTLKIP 134

  Fly   105 KAYNLVQSVVWQTPMSARLTDENF----------TEFSELENWNAQSWGIYQALQMNCQHFFTEC 159
            |.|::.:.:.....::| .||::|          |: :.|...|...|....|:...|..:...|
  Fly   135 KEYDMAEVIAGFDFLNA-FTDQSFEPPGHDSYRATD-AVLRLNNVSIWEAAMAVSPGCFDYVKRC 197

  Fly   160 QWRRKAMNCCD-----LFRPTKTFNGFAFEFNSLVSSGRDETW-PWSVASCGSYSGLNVKIKRQQ 218
            .|......|..     .|.||..:.|....||   .:.|:.:: |:|....|...||.. :..:.
  Fly   198 FWGHTEFQCNQSHEYLSFIPTTAYLGPCCSFN---YNPRNASFVPFSANIFGMDGGLTF-VGAEG 258

  Fly   219 GLYTLNT-MGVIVHEPTQLL---GMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRRCYFENE 279
            ....||| :.|:||.|...:   ..|:..:::....|.|.|...::.::|.....:.|.|....:
  Fly   259 SERNLNTGLIVLVHHPMDYVTEAAASVTITAQSESFVEVSPTVQSSSVEVLELSERKRDCLISGD 323

  Fly   280 IPTGKSR-SECIYKCHVNYIISKCNC-SLELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQH 342
            :.....| :.|:..|....|:.||.| ...||:...:.::             |.:.|..|::  
  Fly   324 LQLSNYRQAACLLACQTEAIVKKCGCHPYLLPIVGNKFKE-------------CNLNDTFCYS-- 373

  Fly   343 RLSLFSMSNIIEESRDNVFSTVDCG-CFPQCGHTQYHTSTYTEKMSAHTNLAA-----------A 395
                        .:.|| |.:|.|. |.|.|....|.|.:|...::.|....:           :
  Fly   374 ------------ANYDN-FKSVRCDQCLPNCYDVTYSTLSYKTDLNQHKYSVSRFYSPELLNNDS 425

  Fly   396 IEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCI 441
            ..:.||..::.:...|.:...:.|.|:...|||..|.:|:|::..:
  Fly   426 FVLRVYLAKQVVPVIRKVTVMSWIGLLSDLGGIFNLCLGLSMISVV 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 90/436 (21%)
ppk6NP_611461.3 ASC 85..476 CDD:279230 87/422 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.