DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and egas-4

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:350 Identity:70/350 - (20%)
Similarity:124/350 - (35%) Gaps:107/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 NWNAQS---WGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVSSGRDETW 197
            :|.|..   |..|:...::....|.  ||..|.:..|             |.||.:.||.:.|  
 Worm   578 SWTAADMFLWVAYEQQLIDLNSNFV--QWNDKVLGNC-------------FTFNHMNSSFKYE-- 625

  Fly   198 PWSVASCGSYSG---LNVKIKRQQGLYTLNTMGVIVHEPTQ---LLGMSIDYSS----EDRIVV- 251
                |....|.|   :.:.:|:.:.|....|.||:|...|:   :...|:..::    |.||.: 
 Worm   626 ----ARSSGYPGGLEMQMNVKQDEYLPWTETAGVMVFTSTKEEAVTSESVRINTAPHFESRIAIN 686

  Fly   252 PVEPLHFTAELDVRARPV-QMRRCYFENEIPTGKSRSECIYKCHVNYIISKCNCSLELPVKATQD 315
            .|:.........|....| :::..|::.:..|    ..|:..|:.:.:...|.|   :..:....
 Worm   687 RVDYYRLGGRYGVCINSVSEVKSYYYDGDYTT----DGCLRSCYQDVVNGDCGC---MDPRYPMP 744

  Fly   316 EDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGCFPQCGHTQYHTS 380
            .|.|:          |.:....|.::           :.:||.:..:..:|.|...|..|     
 Worm   745 NDGIS----------CSISQKTCIDE-----------LVDSRGDPSTWPECTCPLPCSQT----- 783

  Fly   381 TYTEKMS-------------AHTNLAAAIEIDVYFQEETLFSYRSMLRFTL--IDLMV------- 423
            .||.|:|             |:||..|..|         .|....:||.:|  :|.|:       
 Worm   784 VYTSKLSRLPYVNKIVDCEEAYTNKTACYE---------TFLDSVILRISLPKLDYMIYSETPAM 839

  Fly   424 ------SY-GGIAGLIMGISVLGCI 441
                  || |||..:::|:|::..:
 Worm   840 DLTKFMSYLGGILSILIGVSIVSFV 864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 70/349 (20%)
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230 62/315 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.