DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ppk

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_477232.1 Gene:ppk / 34843 FlyBaseID:FBgn0020258 Length:606 Species:Drosophila melanogaster


Alignment Length:515 Identity:117/515 - (22%)
Similarity:192/515 - (37%) Gaps:150/515 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TVYVSILSSERYFYYWVQTSI----ERTDMHVSEIDFPAVTIIPI-------------------- 93
            :||.::......:..|.::.:    :.|.:.|.:|.||.:||.|.                    
  Fly   101 SVYFAVSLIWDTYLKWQESPVILGFDETLVPVHKIPFPTITICPEIKMERNVFDYTNVSRQLWEE 165

  Fly    94 -----NLSILKAEKLSK---AYNLVQSVVWQ--TPMSARLTDENFTEFSELENWNAQSWGIYQAL 148
                 |:|.|..|.|::   |.::..|.|.|  ||:.::|...|......|         |..::
  Fly   166 YKQNGNISDLDDEDLARMAVAMHICDSEVVQRFTPLLSQLNPPNVDVTQTL---------IDLSI 221

  Fly   149 QMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVSSG--RDETW-------------- 197
            ..|....|  |:|..:...|..:|....|..|..::||.|....  |||.:              
  Fly   222 SKNETGPF--CKWNGRFYFCDKIFDFVATDEGICYQFNGLRPKDIYRDEKFISYVDPDVVDFNKY 284

  Fly   198 ------PWSVASCGSYS--------GLNVKIKRQ-------------QGL-----YTLNTM---- 226
                  ||:..: |::|        |.|...:|.             |||     |...:.    
  Fly   285 FDVDLPPWNNIT-GNWSLDTGFVDQGQNAYPQRTVFSSVKNGFFAFLQGLQHNFDYDCRSFKQGY 348

  Fly   227 GVIVHEPTQL---LGMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRRCYFENE----IPTGK 284
            .|.::.|..:   .|..|.....|.::|.|.|.:..:..::.....:.|:|.|::|    .....
  Fly   349 KVFLNSPESVPLTTGNYILVPHGDEVLVSVLPAYVVSTDNLHEITPEKRQCLFDDERSLRFFRSY 413

  Fly   285 SRSECIYKCHVNYIISKCNCS---LELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSL 346
            |:|.|..:|..||.:|||.|:   :..|:                |..:||:||:.|:...:..|
  Fly   414 SQSNCQTECLANYTVSKCGCAKFWMPKPL----------------GTPVCGLKDINCYTSAQDEL 462

  Fly   347 F------SMSNIIEESRDNVFSTVDCGCFPQCGHTQYHTSTYTEKMSA------------HTNLA 393
            :      :|:..|:||.|     :.|.|.|.|...:|:......|...            ||: |
  Fly   463 YTLMQNQTMAKSIDESVD-----ITCNCMPACTSLEYNFEISRAKYDVAKTIRAFREEYEHTD-A 521

  Fly   394 AAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINELLDRFACCRI 453
            ....:.|||:|....:.:..:.|.:..|:.:.|||.||.||||.|..: ||: .|.|.||
  Fly   522 IGSRLSVYFKEHQFTAIKRTILFGVSTLISNCGGICGLFMGISCLSFL-ELI-YFFCMRI 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 113/506 (22%)
ppkNP_477232.1 ASC 69..574 CDD:279230 113/508 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.