DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ppk8

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001036260.3 Gene:ppk8 / 318213 FlyBaseID:FBgn0052792 Length:569 Species:Drosophila melanogaster


Alignment Length:494 Identity:96/494 - (19%)
Similarity:171/494 - (34%) Gaps:140/494 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SSERYFY------------YWVQTSIER--TDMHVSEID----------FPAVTIIPINLSILKA 100
            ||:|.|:            |.:|.:.::  |:..:..||          ||||||..:|.::  |
  Fly    61 SSDRLFFGIALLVVLSLAIYLIQDAFDKWNTNPVIVGIDPELTSIANEPFPAVTICNLNQAL--A 123

  Fly   101 EKLSKAYN-LVQSVVWQTPMSARLTDENFTEFSELENWNAQSWGIY-QALQMNCQHFFTECQWRR 163
            |::....| .|:..:.|. :..|..|      .||...|...|..: ..:...|......|::..
  Fly   124 ERVEHFSNDSVEFAMLQL-LCRRKVD------VELVKTNDSRWEEFILNISQPCNSMVIHCRFGA 181

  Fly   164 KAMNCCDLFRPTKTFNGFAFEFNSL----------------VS---------------------- 190
            ....|..||.|..|..|....||.|                :|                      
  Fly   182 DDYECARLFHPIVTDEGLCCVFNMLHPRFMYRKRVPYSHRNISLPEGFHAVNWHAELGYRKRGFQ 246

  Fly   191 -SGRDETWPWSVASCGSYSGLNVKIKRQQGLY---TLNTMG--VIVHEPTQL-----LGMSIDYS 244
             .|.:..:|......|...||::.:..|...|   :.:::|  :.:|.|.:.     .|:.:...
  Fly   247 PDGDNPLYPRRAQGTGESLGLSLTLDVQADAYYCSSSSSIGFKIALHSPNESPNVRETGVLLAPG 311

  Fly   245 SEDRIVVPVEPLHFTAELDVRARPVQMRRCYFENEIP----TGKSRSECIYKCHVNYIISKCNC- 304
            .|.::  .::|.....|..:|....:.|||.|.||:.    ...::..|:.:|...::|..|.| 
  Fly   312 METKL--RIDPSKILTEKHLRNVDRRSRRCLFHNELKLRWFAHYTQRNCVAECLSGWLIRHCGCV 374

  Fly   305 SLELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRL-SLFSMSNIIEESRDNVFSTVDCGC 368
            :..:|.....|             .||.:....|....|. ::.:|.:.::|            |
  Fly   375 TFYMPRLNAND-------------TICPLHKRECVELIRFRTIIAMESCLDE------------C 414

  Fly   369 FPQCGHTQYHTSTYTEKMS-----------------AHTNLAAAIEIDVYFQEETLFSYRSMLRF 416
            .|.|....:....|:.::|                 |:...:.|: :::||::.|..:.:.....
  Fly   415 LPSCFDLSFSAIAYSTRISLDGFRETPSNGGWNFTDAYVERSVAV-VNMYFKDPTFRANKQTEFI 478

  Fly   417 TLIDLMVSYGGIAGLIMGISVLG---CINELLDRFACCR 452
            ...|.:...||:.||.:|.|.|.   |:...|.|  .||
  Fly   479 GFSDFLSGVGGLMGLFLGFSFLSIAECVYFALIR--PCR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 92/486 (19%)
ppk8NP_001036260.3 ASC 42..508 CDD:279230 92/483 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.