DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and ppk25

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster


Alignment Length:235 Identity:55/235 - (23%)
Similarity:83/235 - (35%) Gaps:68/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DYSSEDRIVVPVEPLHFT-AELDVRARPVQMRRCYF--ENEIP--TGKSRSECIYKCHVNYIISK 301
            |..|:|..::    ||.| ||.:||..||..|:|.|  ||.:.  :....|.|..:|.:.:.:|.
  Fly   255 DIESKDLDIM----LHTTSAESEVRNLPVAYRKCRFSDENNLQYYSPYHPSLCRLECRIKWALSL 315

  Fly   302 CNCSLELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDC 366
            |||.....|.|.:..             ||.|..:.|        .:.|..:|.         .|
  Fly   316 CNCKPYFYVAAPEVP-------------ICTVSGMLC--------LARSKWLER---------PC 350

  Fly   367 GCFPQCGHTQYHTSTYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLR--------FTLIDLMV 423
            .|:|.|....:.....:::.....|.:..     .| |.||.....:.|        |:...|::
  Fly   351 DCYPSCREETFTIFKVSDQTGGDDNYSGE-----RF-ERTLIINLQISRMGINRRVVFSTDQLIM 409

  Fly   424 SYGGIAGLIMGISVL---------------GCINELLDRF 448
            |:||..||.:|.|.:               .|.|....||
  Fly   410 SFGGAIGLFLGASFMTIYGVVYFFLTFIAYTCKNRFCKRF 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 53/231 (23%)
ppk25NP_995766.1 ASC 18..432 CDD:279230 51/216 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.