DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and Asic2

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:498 Identity:105/498 - (21%)
Similarity:168/498 - (33%) Gaps:123/498 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KESKKKLKKEG-----AGGWASTRRYARIPLKIMAALATVYVSILSSERYFYYWVQTSIERTDMH 79
            :.|..:.|..|     ||..|:...:.|..|.::|...::.:.:..|.....||:... ..|.:|
  Rat    58 RPSLSRTKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSLGLLLSWSSNRLLYWLSFP-SHTRVH 121

  Fly    80 ---VSEIDFPAVTIIPINLSILKAEKLSKAYNLVQSVVW---------QTPMSARLT--DE---- 126
               ..::.|||||:  .|.:.|:..:|||. :|..:..|         ..|:.:.|.  ||    
  Rat   122 REWSRQLPFPAVTV--CNNNPLRFPRLSKG-DLYYAGHWLGLLLPNRTARPLVSELLRGDEPRRQ 183

  Fly   127 ------NFTEFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAM---NCCDLFRPTKTFNGFA 182
                  :|..|....::...|......|....:.....|::|.:..   |...:|    |..|..
  Rat   184 WFRKLADFRLFLPPRHFEGISAAFMDRLGHQLEDMLLSCKYRGELCGPHNFSSVF----TKYGKC 244

  Fly   183 FEFNSLVSSGRDETWPWSVASCGSYSGLNVKIKRQQGLYTLNTMGVIVHEPTQLLGMSIDYSSED 247
            :.||    ||.|.....:....|:.:||.:.:..||..| |...|. ..|.|...|:.:...|:.
  Rat   245 YMFN----SGEDGKPLLTTVKGGTGNGLEIMLDIQQDEY-LPIWGE-TEETTFEAGVKVQIHSQS 303

  Fly   248 RIVVPVEPLHFTAELDVRARP--------VQMRRCYFENEIPTGKSRSE--------------CI 290
                  || .|..||.....|        .:.|..|...  |.|:.||.              |.
  Rat   304 ------EP-PFIQELGFGVAPGFQTFVATQEQRLTYLPP--PWGECRSSEMGLDFFPVYSITACR 359

  Fly   291 YKCHVNYIISKCNCSL-ELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIE 354
            ..|...||:..|||.: .:|                      |........||:........::.
  Rat   360 IDCETRYIVENCNCRMVHMP----------------------GDAPFCTPEQHKECAEPALGLLA 402

  Fly   355 ESRDNVFSTVDCGCFPQCGHTQYHTSTYTEKMSAHTNLAAAIE----------------IDVYFQ 403
            |...|.     |.|...|..|:|:......|:.:.|: |..:|                :|::|:
  Rat   403 EKDSNY-----CLCRTPCNLTRYNKELSMVKIPSKTS-AKYLEKKFNKSEKYISENILVLDIFFE 461

  Fly   404 EETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINELLD 446
            .....:......:.:..|:...||..||.:|.|:| .|.||.|
  Rat   462 ALNYETIEQKKAYEVAALLGDIGGQMGLFIGASLL-TILELFD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 96/464 (21%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 104/492 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.