DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and Scnn1g

DIOPT Version :10

Sequence 1:NP_651706.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_058742.2 Gene:Scnn1g / 24768 RGDID:3641 Length:650 Species:Rattus norvegicus


Alignment Length:533 Identity:104/533 - (19%)
Similarity:180/533 - (33%) Gaps:202/533 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YFYYWVQTSIERTDMHVSEIDFPAVTIIPIN----------LSILKAE---KLSKAYNLVQS--- 112
            :.:|.|..||:   :|..::|||||||..||          |:.|.:|   .|...|.:.:|   
  Rat    76 FSFYTVSVSIK---VHFQKLDFPAVTICNINPYKYSAVSDLLTDLDSETKQALLSLYGVKESRKR 137

  Fly   113 -VVWQTPMSARLTDENFTE------FSELENWNAQSWG-----------IYQALQMN-------- 151
             .....|.:...|...|.:      |:|.|...|:.:.           |::|..:.        
  Rat   138 REAGSMPSTLEGTPPRFFKLIPLLVFNENEKGKARDFFTGRKRKISGKIIHKASNVMHVHESKKL 202

  Fly   152 -----CQHFFTEC-------------QWRR-------------KAMN-----------C------ 168
                 |.:..::|             :|.:             |.:|           |      
  Rat   203 VGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMSYSAKELLVTCFFDGMS 267

  Fly   169 CD----------LFRPTKTFN-------------GFAFEFNSLVSSGRDETWPWSVASCGSYSGL 210
            ||          ::....|||             |..:....::....||..|:.|:|    :|.
  Rat   268 CDARNFTLFHHPMYGNCYTFNNKENATILSTSMGGSEYGLQVILYINEDEYNPFLVSS----TGA 328

  Fly   211 NVKIKRQQGLYTLNTMGVIVHEP---------TQLLGMSIDYS--SEDRIVVPVEPLHFTAELDV 264
            .|.|.:|.....:..:|:.:...         |:...:|..||  :||...|||..::..|    
  Rat   329 KVLIHQQNEYPFIEDVGMEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAA---- 389

  Fly   265 RARPVQMRRCYFENEIPTGKSRSECIYKCHVNYIISKCNC---SLELPVKAT----QDEDN---- 318
                               .|...|:|.|....::.||.|   |..||..|.    |...|    
  Rat   390 -------------------YSLQICLYSCFQTKMVEKCGCAQYSQPLPPAANYCNYQQHPNWMYC 435

  Fly   319 -----IAAAKESNG-RRICGVKDLACFNQHRLSLFSMSNIIEESRD----NVFSTVDCGCFPQCG 373
                 .|..:|..| :.:|  |....|.:..|:. |::....|:.:    ||.:           
  Rat   436 YYQLYQAFVREELGCQSVC--KQSCSFKEWTLTT-SLAQWPSEASEKWLLNVLT----------- 486

  Fly   374 HTQYHTSTYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLR--FTLIDLMVS-YGGIAGLIMGI 435
               :..|....|....|:||..:   :::::   .:.||::.  ...|::::| :||..||.|..
  Rat   487 ---WDQSQQINKKLNKTDLAKLL---IFYKD---LNQRSIMESPANSIEMLLSNFGGQLGLWMSC 542

  Fly   436 SVLGCINELLDRF 448
            ||: |:.|:::.|
  Rat   543 SVV-CVIEIIEVF 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_651706.1 ASC 47..446 CDD:459966 103/529 (19%)
Scnn1gNP_058742.2 ENaC 24..631 CDD:273304 104/533 (20%)
Gating release of inhibition by proteolysis (GRIP), protease-sensitive region that is responsible for the proteolytic activation of the channel. /evidence=ECO:0000250|UniProtKB:P51170 135..222 11/86 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..628
PY motif, mediates interaction, ubiquitination and inhibition by NEDD4 and NEDD4L. /evidence=ECO:0000269|PubMed:12654927 624..628
PY motif, recruits WW domain-containing proteins and is thereby required for ubiquitination and inhibition of the channel by NEDD4 and NEDD4L. /evidence=ECO:0000250|UniProtKB:P51170 624..628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.