DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and del-5

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:329 Identity:74/329 - (22%)
Similarity:121/329 - (36%) Gaps:81/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 HFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFN-----SLVSSGRDETWPWSVASCGSY----SG 209
            |:|      |...:.||.:....||:|....||     ||:      .|...|.:|..:    .|
 Worm    54 HYF------RAGHDGCDEYTNLTTFHGMIRVFNSRNCPSLI------FWCLVVTTCLVFYIMVCG 106

  Fly   210 LNVK-IKRQQGLYTLN-------------------TMGVIVHEPTQLLGMSID-YSSEDRIVVPV 253
            ..:| ...|.....:|                   |...|:.|..|:....:| |...       
 Worm   107 TMIKTYSTQPSFMRINETKSHRAENNIELCSEKQLTCNEILKENKQMTCKEVDAYCVS------- 164

  Fly   254 EPLHFTAELDVRARPVQMRRCYFENEIPTGKSRSECIYKCHVNYIISKCNCSLELPVKATQ-DED 317
              :.|:.:..:|   ::.:..||::    |....       |:|:.||.:....:.:|..| |..
 Worm   165 --IRFSTKTKIR---LKKKGLYFKH----GTEED-------VHYLSSKPHTHHMIRLKLIQIDRL 213

  Fly   318 NIAAAK-ESNGRRICGV-KDLACFNQHRLSLFSMSNI-IEESRDNVFSTVDCGCFPQCGHTQYHT 379
            |:..|. .:|.|.|..: ||  ....:|.||....|| .|.:|...:...|..|:|.|...:|..
 Worm   214 NLGRAPCTTNWREITWIEKD--SIPDYRYSLNMCENIRFELTRKVEYLQYDFPCYPSCSEIKYQV 276

  Fly   380 STYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINEL 444
            |   :....|::.:..|...|.   .|:...:...:.||||::...||.:.|.||.|   |:. |
 Worm   277 S---KSKLRHSSDSVVITFSVL---PTITLMQETRKTTLIDILCYLGGASSLFMGCS---CVT-L 331

  Fly   445 LDRF 448
            ::.|
 Worm   332 MEMF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 73/325 (22%)
del-5NP_509838.2 ASC 66..337 CDD:295594 69/311 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.