DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and delm-2

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_491296.1 Gene:delm-2 / 182851 WormBaseID:WBGene00016063 Length:608 Species:Caenorhabditis elegans


Alignment Length:473 Identity:97/473 - (20%)
Similarity:165/473 - (34%) Gaps:116/473 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RRYARIPLKIMA----ALATVYVSILSSERYFYYWVQTSIERTDMHVSE--IDFPAVTI---IPI 93
            :|:|.:...||.    .|....|.||:|.    |..:..:......::|  |.||.:||   .||
 Worm    84 KRWATLFWLIMVCTSIGLLITQVCILASN----YLSKPVVSDVSFLINEEGIQFPQITICNFTPI 144

  Fly    94 NLSIL----KAEKLSKAYNLVQSVV-WQTPMSARLTDENFTEFSE---------LENWNAQSWGI 144
            ..:.:    |..::|.  |::..:: |.|.:...:...|:....|         ..|.|....|.
 Worm   145 RKTFVNEMNKTGQISP--NMINYIMHWFTEVPILIGSSNWQLLHEGNKDLQEYQKNNPNFTVQGF 207

  Fly   145 YQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVS---SGRDETWPWSVASCGS 206
            :.....:|...|..|.::.:..:||.:..|..|..|..:..:.|.|   |...:|.|      |.
 Worm   208 FIDAGFSCSDIFKLCSFQGETFDCCSISTPVLTPLGKCYTLDLLSSTKPSMHKQTEP------GI 266

  Fly   207 YSGLNVKI-----------KRQQGLYT---LNTMGVIVHEPTQLLGMSIDYSSEDRIVVPVEPLH 257
            .:||.:.:           .....|:|   :|.....||.|.     :|.:.|.|...|....:.
 Worm   267 QAGLAITLDAHLEEQFDGSNGMDALFTNSFVNGFQYFVHPPN-----TIPHLSSDEFTVTPNSVA 326

  Fly   258 FTAELDVRARPVQMRR---CYFENEIPTG-KS-----RSECIYKCHVNYIISKCNCSLELPVKAT 313
            :||....|...:...:   |  ....|:| ||     ...|:..|...:.:..|.|:   |.   
 Worm   327 YTAISSERFELLPTNKWGNC--TEHYPSGIKSDLPYLTGNCVSLCKAKFFMENCGCT---PA--- 383

  Fly   314 QDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCG-CFPQCGHTQY 377
                  ....|.|.:.....:.|||.|.|..|..:...:       .|....|. |..||.:..|
 Worm   384 ------VYNNERNLKECTPFETLACVNNHNGSNNATGKL-------EFKLPRCAQCAQQCNNLIY 435

  Fly   378 --------------------HTSTYTEKMSAH--TNLAAAIEIDVYFQEETLFSYRSMLRFTLID 420
                                :.|.:|   .||  ||...   |.:::|:.:...|..:...::.|
 Worm   436 RAFNSQGNQFSARAFEWFRTNNSNWT---MAHIKTNFQI---IHIFYQDMSNTEYNQVQDASISD 494

  Fly   421 LMVSYGGIAGLIMGISVL 438
            |:.:.||..|:.:|:|::
 Worm   495 LLSNIGGNMGMFLGMSLI 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 95/464 (20%)
delm-2NP_491296.1 ASC 68..520 CDD:279230 97/473 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.