DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and del-1

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001355359.1 Gene:del-1 / 181534 WormBaseID:WBGene00000952 Length:694 Species:Caenorhabditis elegans


Alignment Length:199 Identity:46/199 - (23%)
Similarity:71/199 - (35%) Gaps:57/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 QMRRCY--FENEIPTGKSRSECIYKCHVNYIISKCNCS---LELPVK--ATQDEDNIAAAKESNG 327
            |.|..|  ::.| |.|     |...|:...||:||.|:   ...|.|  |..|..|...      
 Worm   489 QSRSIYKGYKYE-PEG-----CFRSCYQYRIIAKCGCADPRYPKPWKRSAWCDSTNTTT------ 541

  Fly   328 RRICGVKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGCFPQCGHTQYHTSTY---------- 382
                    |.|.......|.:..|           ...|.|...|...|| |:||          
 Worm   542 --------LNCLTTEGAKLSTKEN-----------QKHCKCIQPCQQDQY-TTTYSAAKWPSGSI 586

  Fly   383 -------TEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGC 440
                   ::..:::....||: |::|:::.:....|....::..:||...||.|||.:|.|::..
 Worm   587 QTSCDNHSKDCNSYLREHAAM-IEIYYEQMSYEILRESESYSWFNLMADMGGQAGLFLGASIMSV 650

  Fly   441 INEL 444
            |..|
 Worm   651 IEFL 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 46/199 (23%)
del-1NP_001355359.1 deg-1 75..656 CDD:273309 46/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.