DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and del-6

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:534 Identity:98/534 - (18%)
Similarity:180/534 - (33%) Gaps:159/534 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KPEPSSEDND----DDHKESKKKLKKEGAGGWASTRRYARIPLKIMAALATVYVSILSSERYFYY 67
            |.:.|.|.:|    ..|.|..|....:.|......|:||.:.:....|:.||.......|.||.|
 Worm     6 KDQTSVEMHDIPKNQAHPEDDKPHSWKDALFGRRARKYAFVFIVAFLAVLTVKDVFDLFEEYFDY 70

  Fly    68 WVQTSIERTDMHV---SEIDFPAVTI----------IPINLS-------ILKAEKLSKAYNLVQS 112
                 .:.:|:::   ..:..|.||.          ..:||:       .:..|.|:...:  ..
 Worm    71 -----PKESDINIVFNESMTMPNVTFCMSRQQAWSHFKLNLTAPADEWDAVVDENLANMTD--HD 128

  Fly   113 VVWQTPMSARLTDENF---TEFSELE-----NWNAQSWGIYQALQMNCQHFFTECQWR------- 162
            ...:||...||..|.:   ..:|.||     :.:|:|..:::..........|..:||       
 Worm   129 AFMKTPWDYRLVMEAYDMIATYSSLERETTAHGSARSIHVFKNAPRLAAKRKTFKKWRDILDSRG 193

  Fly   163 ---------------RKAMNCCDLFRPTKTFNGFAFEFNSLVSSGRDETWPWSVASC--GSYSGL 210
                           |::|   ..|| .:||:    :..:::.:....:|...:..|  ..:...
 Worm   194 ITFDEFTQKTGIEVLRRSM---QRFR-RRTFD----DDETVIKTKLRISWISQMQICFQPEFDQD 250

  Fly   211 NVKIKRQQGLY--------TLNTMGVIVHEPTQLLGMSIDY---------------SSEDRIVVP 252
            |.|....||::        ..||.|      .::..||:|:               .|.|..|..
 Worm   251 NFKTIDDQGVFFDMLLSHNAENTEG------QKIDCMSVDFHGRPSSLNRFMEGKGRSRDGYVDE 309

  Fly   253 V-------EPLHFTAELDVRARPVQMRRCYFENEIPTGK-SRSECIYKCHVNYIISKCNCS-LEL 308
            |       ...|.||...:.....|..||   .::..|: |...|..:|.:..|...|:|: |.|
 Worm   310 VCLGQRHEVTAHVTALYQMLENDEQGTRC---RDVEDGEDSEFNCRSRCRMEMIRDACHCTPLSL 371

  Fly   309 PVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSN----IIEESRDNVFSTVDCG-- 367
            ...|.:::                           :.:|.:.:    .::..:.| :|..:|.  
 Worm   372 SYLAKKED---------------------------MEIFPLCDYTQCTVDVQKGN-YSDTECANK 408

  Fly   368 CFPQCGHTQYHTSTYTEKMSAHTNLAAAIEIDVYFQEETL--FSYRSM---LRFTLIDLMVSYGG 427
            |||.|...::...        |:.....:..|:...|.:.  |.|.:|   .:::....:.:.||
 Worm   409 CFPDCRQIRFEVD--------HSVKGRMLRPDLTLVELSWGPFEYLTMEQQWKYSATSFIAALGG 465

  Fly   428 IAGLIMGISVLGCI 441
            ..|:.:|:|:|..|
 Worm   466 SIGMWLGLSILSLI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 87/490 (18%)
del-6NP_741622.2 ASC <347..484 CDD:295594 30/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.