DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and LOC103910008

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_009296668.1 Gene:LOC103910008 / 103910008 -ID:- Length:99 Species:Danio rerio


Alignment Length:56 Identity:14/56 - (25%)
Similarity:26/56 - (46%) Gaps:6/56 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VSILSSERYFYYWVQTSIE------RTDMHVSEIDFPAVTIIPINLSILKAEKLSK 105
            ::||....|.|..::..:|      |.|...::....|.|:..:||..:||:..|:
Zfish    10 LTILEILDYVYEVIKHRLERLLRPQRDDKKQTQQQQQASTVATVNLEEMKAKDSSE 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 14/56 (25%)
LOC103910008XP_009296668.1 ASC <1..32 CDD:295594 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.