DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and LOC101731449

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_031747978.1 Gene:LOC101731449 / 101731449 -ID:- Length:534 Species:Xenopus tropicalis


Alignment Length:458 Identity:90/458 - (19%)
Similarity:172/458 - (37%) Gaps:139/458 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YWVQTSIERTDMHVS--EIDFPAVTIIPINLSILKAEKLSKAYNLVQSV-------------VWQ 116
            |:...|.|:. |.:|  ::.||||||  .||:.::...|.:::::..|:             ...
 Frog    80 YYTYPSHEKI-MLISSAKLKFPAVTI--CNLNSVRLSSLGRSFSMSNSLQDSGLEMTHRRNRSHH 141

  Fly   117 TPMSARLTDENF----------TEFSELENWNAQSWGIYQALQMNCQ--HFFTECQWRRKAMNCC 169
            ..:::...|||.          :||::|.:        .|.::|..|  .....|.:..:..|  
 Frog   142 MNVTSDSVDENVLYASAFNKFASEFNQLPD--------EQKIEMGHQLEDMLIFCNFHGQECN-- 196

  Fly   170 DLFRPTKTFNGF-------AFEFNSL----VSSGRDETWPWSVASCGSYSGLNVKIKRQQGLYT- 222
                 :..|:||       .:.|||.    :...:....|.::...|...||::::..||..|. 
 Frog   197 -----SSFFSGFINYKFGNCYTFNSQKSVDIRGNQIRVDPLNITKAGFMYGLHLELFIQQIEYVR 256

  Fly   223 --LNTMGV--IVHEPTQLLGMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRR--------C- 274
              .:..|:  :||:..|:     .:..::.:.||.     .||.::....|.:.|        | 
 Frog   257 DMTHAAGIRLLVHDQAQM-----PFPEDEGVNVPP-----GAETEIGMMKVHINRLRAPYGSHCT 311

  Fly   275 -------YFENEIPTGKSRSECIYKCHVNYIISKCNCSLELPVKATQDEDNIAAAKESNGRRICG 332
                   ::::....|.:|..|...|....|:..|.|:          ....|..||.|..: |.
 Frog   312 QGEGIKNFYKDIYGAGYTREACKRTCAQQSIMDNCGCT----------HWEFAFPKEGNYPK-CN 365

  Fly   333 VKDLACFNQHRLSLFSMSNIIEESRDNVFSTVDCGCFPQCGH---------TQYHTSTYTEKMSA 388
            |.:.|..:..:|..|..::          ..::|.|..||..         :|:.::.:.|..|.
 Frog   366 VSNAAIRDCVKLYEFKFAH----------DELNCHCPLQCSEDLYELTVSGSQWPSTAFIENFSR 420

  Fly   389 H--------TNLAAA--------IEIDVYFQE---ETLFSYRSMLRFTLIDLMVSYGGIAGLIMG 434
            .        .::|.:        :::.|||::   |.:....||   |.|:|:.:.||:.||.:|
 Frog   421 ELKEMGGQMRDIADSPSMIRDNFVKVVVYFKQLNFELIEEEPSM---TEINLISNMGGLVGLWVG 482

  Fly   435 ISV 437
            .||
 Frog   483 FSV 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 90/458 (20%)
LOC101731449XP_031747978.1 ASC 35..494 CDD:395688 90/458 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.