DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and asic5

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_017951381.2 Gene:asic5 / 100498195 XenbaseID:XB-GENE-983430 Length:852 Species:Xenopus tropicalis


Alignment Length:494 Identity:110/494 - (22%)
Similarity:185/494 - (37%) Gaps:153/494 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKKEGAGGWASTRRYARIPLKIMAALATVYVSILSSE------RYFYYWVQTSIERTDMHVSEID 84
            |.:.|..|..|..|.|     |..::.:|::.:...:      .||.:...||:  ...:|..||
 Frog   399 LVENGGSGKNSKFRTA-----IWTSVVSVFIIMACWQVCTRVINYFSWPTTTSV--NVQYVENID 456

  Fly    85 FPAVTIIPINLSILKA-EKLSKAY---NLVQSVVWQTPMSA------RLTD-----ENFT--EFS 132
            |||:|...:|....|| ..||.|:   |:|.:|:..|.:::      .:||     :||:  ||:
 Frog   457 FPAITFCNLNRFQTKAVNNLSIAFFLWNIVSAVLHFTSIASDPGEMQEVTDFLKLNKNFSIKEFT 521

  Fly   133 ELENWNAQSWGIY--QALQMNC------------QHFFTECQWRRKAMNCCDLFRPTKTFNGFAF 183
                   :::|.|  .:..:.|            :|.|||..      ||            :.|
 Frog   522 -------KNYGFYLNNSTLLKCSFFGYPCYPEDFEHIFTEYG------NC------------YTF 561

  Fly   184 EFNSLVSSGRDETWPWSVASCGSYSGLNVKIKRQQGLYTLNTMGVIVHEPTQLLGMSIDYSSEDR 248
            .:|::..:.|       :.:.|  .||:|....:|..:|        .||:  ||. :|......
 Frog   562 NYNTVSMNKR-------ITTAG--RGLSVLFDIKQTEFT--------DEPS--LGF-VDAGISFV 606

  Fly   249 IVVPVEP-------LHFTAELDVRARPVQMRRCYFE---NEIPTGK-------------SRSECI 290
            :..|:.|       ||..|.:...   |.|||  |:   .|.|.|:             |...|:
 Frog   607 LHSPLVPPRFDGLGLHSPAGMHAH---VSMRR--FKTVIQEHPWGECNPSLKLKYHEIYSTYGCL 666

  Fly   291 YKCHVNYIISKCNCSLELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEE 355
            .:|...||.::|.|              |......||:. |.::.|  :|....:|::    ||:
 Frog   667 QECKSYYIQNECGC--------------IPFLLPGNGKE-CDLQQL--YNCVSRALYT----IEK 710

  Fly   356 SRDNVFSTVDCGCFPQCGHTQYHT----STY-----TEKMSAHTNLAA------AIEIDVYFQEE 405
            |......|.:..|...|..|.:..    ||:     .:.:||..:.:|      .:.||:.:.|.
 Frog   711 SELCSMGTYNSTCPVPCEETDFPATISYSTFPSDKAAQFLSAKLSKSALYMRNNLVYIDIKYHEM 775

  Fly   406 TLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINEL 444
            .....:.....|..:|:.:.||..||..|.|::..|..|
 Frog   776 NYKIMKQQKALTASELLSNIGGQLGLFCGASMITIIEVL 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 104/473 (22%)
asic5XP_017951381.2 Inhibitor_I29 66..129 CDD:400519
Peptidase_C1A 158..360 CDD:239068
ASC 387..816 CDD:395688 110/494 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.