DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk30 and asic4

DIOPT Version :9

Sequence 1:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_031749131.1 Gene:asic4 / 100486325 XenbaseID:XB-GENE-940165 Length:535 Species:Xenopus tropicalis


Alignment Length:510 Identity:107/510 - (20%)
Similarity:174/510 - (34%) Gaps:140/510 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DNDDDHKESKKKLKKEG------------AG----GWASTR---------RYARIPLK----IMA 49
            |.|.:.||     |:||            ||    .:|||.         :..|:.:|    .:|
 Frog    13 DEDGNQKE-----KEEGERESLIGDEVPAAGRDLAAFASTSTLHGLRHIFQTGRLGIKQSLWALA 72

  Fly    50 ALATVYVSILSSERYFYYWVQ----TSIERTDMHVSEIDFPAVTIIPINLSILKAEKLSKAYNLV 110
            .||::...:....:...|:::    |:::...|  .|:.|||:||..||.....|......|:|.
 Frog    73 FLASLLFFLYQVAKCALYYLEHPHVTAVDEEVM--GEMIFPAITICNINRFRHSALTDPDIYHLA 135

  Fly   111 QSVVWQTPMSA---RLTDENFTEFSELENWNAQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLF 172
             ::....|...   |.:|..:.:...|:..|.....:.:.|: :|......|    .|.|...:|
 Frog   136 -NLTGLPPKDREGHRDSDLMYDDPDMLDIVNRTGHQLAEMLK-SCNFSGDSC----SAQNFSVVF 194

  Fly   173 RPTKTFNGFAFEFNSLVSSGRDETWPWSVASCGSYSGLNVKIKRQQGLY------TLNT-----M 226
                |..|..:.||:      |:..|......|..:||.:.:..||..|      |..|     :
 Frog   195 ----TRYGKCYTFNA------DKKHPKVSRQGGMGNGLEIMLDIQQEEYLPIWRETNETSFEAGI 249

  Fly   227 GVIVH---EPTQLLGMSIDYSSEDRIVVPVEPLHFTAELDVRARPVQMRRCYFENEIP-----TG 283
            .|.:|   ||..:..|....|...:..|..:....|      ..|.....|  .:.||     :|
 Frog   250 RVQIHSQDEPPYIHQMGFGVSPGFQTFVSCQEQRMT------YLPQPWGNC--RSSIPGEEFLSG 306

  Fly   284 KSR---SECIYKCHVNYIISKCNCSL-ELPVKATQDEDNIAAAKESNGRRICGVKDLACFNQHRL 344
            .|.   |.|..:|....:|.||.|.: .:|...|                ||......|.:.   
 Frog   307 YSTYSISACRLQCEKEAVIRKCACRMVHMPGNET----------------ICSPVMYMCADH--- 352

  Fly   345 SLFSMSNIIEESRDNVFSTVDCGCFPQCGHTQYHTSTYTEKMSAHTNLAAA-------------- 395
               .:.|::|::.:.      |.|...|..|:|....   .|....|..:|              
 Frog   353 ---ILDNMVEDTSEK------CSCPTPCNLTRYSKEI---SMVRIPNKGSARYLARKYNKNETYI 405

  Fly   396 ----IEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGISVLGCINELLD 446
                :.:|::|:.....:......:.|..|:...||..||.:|.|.| .|.|:||
 Frog   406 RENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFL-TILEILD 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk30NP_001263076.1 ASC 47..446 CDD:279230 91/446 (20%)
asic4XP_031749131.1 ASC 39..514 CDD:413546 98/479 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.