DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ASIC5

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:518 Identity:115/518 - (22%)
Similarity:195/518 - (37%) Gaps:133/518 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DYAAESSVHGIRYLAD--PKMRNYLNIRVIWLLILL-TTSIGAIVVYVDLNELYQTVRIQTTIKN 111
            |:|..:|.|||..:..  .|:|     ||:||:::| :.|:....:|:.|.. |.|....|:|: 
Human    40 DFAISTSFHGIHNIVQNRSKIR-----RVLWLVVVLGSVSLVTWQIYIRLLN-YFTWPTTTSIE- 97

  Fly   112 TMLPIFRIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEM 176
             :..:.::.||::..|..||     .:|:||..| |.        :|..:...:...||..:.  
Human    98 -VQYVEKMEFPAVTFCNLNR-----FQTDAVAKF-GV--------IFFLWHIVSKVLHLQEIT-- 145

  Fly   177 SNFFGNKTLTDELHMLDHLDLREVYKFIQ----FRCQDLFHTCRWRGNPVNCCEVIEYQ--FTEA 235
            :|..|::..||  ....|.:. .:.:||:    :........|.:.|.|   |...::.  |||.
Human   146 ANSTGSREATD--FAASHQNF-SIVEFIRNKGFYLNNSTLLDCEFFGKP---CSPKDFAHVFTEY 204

  Fly   236 GLCFVFNTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNR---------SFIRPGKRGIN 291
            |.||.||...:..:::|...            .|.||.|...:|:         .|:   ..||.
Human   205 GNCFTFNHGETLQAKRKVSV------------SGRGLSLLFNVNQEAFTDNPALGFV---DAGII 254

  Fly   292 VMIKQPQ---QWSDVVRHVPHEAHTRISITPRFTVTDERTRTVTPEI--RRCIFGDEVDNPHYK- 350
            .:|..|:   |:..:....|...|.|::|        .:.:||..|.  ..|       ||:.| 
Human   255 FVIHSPKKVPQFDGLGLLSPVGMHARVTI--------RQVKTVHQEYPWGEC-------NPNIKL 304

  Fly   351 -NFPDFEYWVGNCRSRCHQEHVLNLCKCSPSIF--FPIS-DKDNFTACKASDFKCLYDNRFTFSI 411
             ||.  .|....|...|..:|:...|.|.|.:.  :.|. |...:.:|.:             .:
Human   305 QNFS--SYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSCVS-------------PV 354

  Fly   412 ERHPEEDDFVKNPFKESMIC-------DCFTSCSQLVFDRV-------------FTTTTLDNNET 456
            ..|.|        ||:  :|       .|..||.::.:...             :.:..|:.:..
Human   355 LDHIE--------FKD--LCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRK 409

  Fly   457 DTEAGTMRLDIFYQSGWFIQYQTNMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIGLY 519
            ......::::|.|....:...|.....:..||||..||.:|||.||||::..|:..|.....|
Human   410 YIRENLVKIEINYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFY 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 112/509 (22%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 112/509 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.