DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ppk30

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001263076.1 Gene:ppk30 / 43487 FlyBaseID:FBgn0039677 Length:457 Species:Drosophila melanogaster


Alignment Length:457 Identity:116/457 - (25%)
Similarity:197/457 - (43%) Gaps:76/457 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RNYLNIRVIWLLILLTTSIGAIVVYVDL--NELYQTVRIQTTIKNTMLPIFRIPFPSIGLCPRNR 131
            |.|..|.:..:..|.|       |||.:  :|.|....:||:|:.|.:.:..|.||::.:.|   
  Fly    38 RRYARIPLKIMAALAT-------VYVSILSSERYFYYWVQTSIERTDMHVSEIDFPAVTIIP--- 92

  Fly   132 LNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEMSNFFGNKTLTDELHMLDHLD 196
            :|..||:.|.:........|...:           .|..:||.: .||       .|...|::.:
  Fly    93 INLSILKAEKLSKAYNLVQSVVWQ-----------TPMSARLTD-ENF-------TEFSELENWN 138

  Fly   197 LRE--VYKFIQFRCQDLFHTCRWRGNPVNCCEVIEYQFTEAGLCFVFNTEISPASRQKAREDKYY 259
            .:.  :|:.:|..||..|..|:||...:|||::.....|..|..|.||:.:|      :..|:.:
  Fly   139 AQSWGIYQALQMNCQHFFTECQWRRKAMNCCDLFRPTKTFNGFAFEFNSLVS------SGRDETW 197

  Fly   260 PLRTPHYGEGSGLDLFLRLNRSFIRPGKRGINVMIKQPQQWSDVVRHVPHEAHTRISITP-RFTV 323
            |......|..|||::.::..:........|  |::.:|.|...:......|....:.:.| .||.
  Fly   198 PWSVASCGSYSGLNVKIKRQQGLYTLNTMG--VIVHEPTQLLGMSIDYSSEDRIVVPVEPLHFTA 260

  Fly   324 -TDERTRTVTPEIRRCIFGDEVDNPHYKNFPDFEYWVGNCRSRCHQEHVLNLCKCSPSIFFPI-- 385
             .|.|.|.|  ::|||.|.:|:.....::         .|..:||..::::.|.|  |:..|:  
  Fly   261 ELDVRARPV--QMRRCYFENEIPTGKSRS---------ECIYKCHVNYIISKCNC--SLELPVKA 312

  Fly   386 -SDKDNFTACKAS---------DFKCLYDNRFT-FSIERHPEEDDFVKNPFKESMICDCFTSCSQ 439
             .|:||..|.|.|         |..|...:|.: ||:....||..  .|.| .::.|.||..|..
  Fly   313 TQDEDNIAAAKESNGRRICGVKDLACFNQHRLSLFSMSNIIEESR--DNVF-STVDCGCFPQCGH 374

  Fly   440 LVFDRVFTTTTLDNNETDTE-AGTMRLDIFYQSGWFIQYQTNMRFTFVELLASFGGIIGLFLGAS 503
            ..:   .|:|..:.....|. |..:.:|:::|......|::.:|||.::|:.|:|||.||.:|.|
  Fly   375 TQY---HTSTYTEKMSAHTNLAAAIEIDVYFQEETLFSYRSMLRFTLIDLMVSYGGIAGLIMGIS 436

  Fly   504 LL 505
            :|
  Fly   437 VL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 116/457 (25%)
ppk30NP_001263076.1 ASC 47..446 CDD:279230 113/448 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 1 1.000 - - FOG0009975
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.