DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and asic2

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_005164179.1 Gene:asic2 / 407669 ZFINID:ZDB-GENE-040513-4 Length:564 Species:Danio rerio


Alignment Length:506 Identity:107/506 - (21%)
Similarity:191/506 - (37%) Gaps:114/506 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AESSVHGIRYLADPKMRNYLNIRVIWLLILLTTSIGAIVVYVDLNELYQTVRIQTTIKNTMLPIF 117
            :.:.:||:|::..|.  |.|:.|..| :|...|.:|.::.: ..|.|...:...|..:.......
Zfish    69 SRTRLHGLRHICSPS--NSLSRRAFW-MIAFCTCLGLLLSW-SSNRLLHWLAFPTHTRVHTEWAK 129

  Fly   118 RIPFPSIGLCPRNRLN-WKILETEA--VDHFLG---ANVSAAQKDLFVKFFTAAGDPHLSRLNEM 176
            .:.||::.:|..|.:. :.:.:::.  ..|:||   ||.:|  :.|.:...........|:|::.
Zfish   130 ELAFPTVTICNNNPVRLYHLTKSDLYFAGHWLGLLLANRTA--RPLVLDLLQDDRRGWFSKLSDF 192

  Fly   177 SNFFGNKTLT-DELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIEYQ--FTEAGLC 238
            ..|...:... ..|..:|.|.         .:.:|:...|::||.|   |....:.  ||..|.|
Zfish   193 RLFLPPRRFEGTSLEFMDRLG---------HQLEDMLLACKYRGEP---CGAHNFSTVFTRYGKC 245

  Fly   239 FVFNTEISPASRQKAREDKYYPLRTP-HYGEGSGLDLFLRLNRSFIRP---------GKRGINVM 293
            ::||.         |.|.|  .|||. ..|.|:||::.|.:.:....|         .:.|:.|.
Zfish   246 YMFNA---------AEEGK--TLRTTMKGGTGNGLEIMLDIQQDEYLPVWGETEETAFEAGVRVQ 299

  Fly   294 IKQPQQWSDVVRHVPHEAHTRISITP---RFTVTDERTRT-VTPEIRRCIFGDEVDNPHYKNFPD 354
            |....:       .|........:.|   .|..|.|:..| :.|....|: ...:|:..::    
Zfish   300 IHSQAE-------PPFVHELGFGVAPGFQTFVATQEQRLTYLPPPWGECV-SRALDSGLFQ---- 352

  Fly   355 FEYWVGNCRSRCHQEHVLNLCKCSPSIFFPISDKDNFTACKASDFK-----------------CL 402
             .|.|..||..|...:::..|.|. .::.|    .:...|....:|                 |:
Zfish   353 -VYSVSACRIECETRYIVENCNCR-MVYMP----GDSPYCTPEQYKDCAEPALAALSAVEGTNCI 411

  Fly   403 YDNRFTFSIERHPEEDDFVKNPFKES--MICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTMRL 465
            .  |...::.|:.:|...||.|.|.|  .:...|....:.:.|.:..                 |
Zfish   412 C--RSPCNMTRYNKELSMVKIPSKTSARYLEKKFNRSEKYITDNILV-----------------L 457

  Fly   466 DIFYQSGWFIQYQT---NMRFTFVELLASFGGIIGLFLGASLLSAFELAYY 513
            |:|:::   :.|:|   ...:....||...||.:|||:|||:|:..||..|
Zfish   458 DVFFEA---LNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTLLELFDY 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 106/504 (21%)
asic2XP_005164179.1 ASC 71..538 CDD:295594 107/504 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.