DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ASIC2

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_899233.1 Gene:ASIC2 / 40 HGNCID:99 Length:563 Species:Homo sapiens


Alignment Length:588 Identity:126/588 - (21%)
Similarity:211/588 - (35%) Gaps:166/588 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLELPRARRPLYRDYGGKSG--LIQTQRDARKNSRLGKLWHFMLPYLKDYAAESSVHGIRYLADP 66
            |..|..|.:|    .||:.|  .:|....||:..          |.|    :.:.:||:|::...
Human    29 PAALAAAGQP----GGGRGGERALQGPGVARRGR----------PSL----SRAKLHGLRHMCAG 75

  Fly    67 KMR--NYLNIRVIWLLILLTTSIGAIVVYVDLNELY-----QTVRIQTTIKNTMLPIFRIPFPSI 124
            :..  .....|.:|:| ...||.|.::.:.....||     ...|:......      ::|||::
Human    76 RTAAGGSFQRRALWVL-AFCTSFGLLLSWSSNRLLYWLSFPSHTRVHREWSR------QLPFPAV 133

  Fly   125 GLCPRNRLNWKIL---ETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEMSNFFGNKTLT 186
            .:|..|.|.:..|   :.....|:||..:........|.......:|......::::|   :...
Human   134 TVCNNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSELLRGDEPRRQWFRKLADF---RLFL 195

  Fly   187 DELH-------MLDHLDLREVYKFIQFRCQDLFHTCRWRG---NPVNCCEVIEYQFTEAGLCFVF 241
            ...|       .:|.|.         .:.:|:..:|::||   .|.|...|    ||:.|.|::|
Human   196 PPRHFEGISAAFMDRLG---------HQLEDMLLSCKYRGELCGPHNFSSV----FTKYGKCYMF 247

  Fly   242 NTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRP---------GKRGINVMIKQP 297
            |          :.||....|.|...|.|:||::.|.:.:....|         .:.|:.|.|...
Human   248 N----------SGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQ 302

  Fly   298 QQWSDVVRHVPHEAHTRISITP---RFTVTDERTRTVTP----EIRRCIFGDEVDNPHYKNFPDF 355
            .:       .|........:.|   .|..|.|:..|..|    |.|....|.:.       ||  
Human   303 SE-------PPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDF-------FP-- 351

  Fly   356 EYWVGNCRSRCHQEHVLNLCKC---------------------SPSIFFPISDKD-NFTACKASD 398
            .|.:..||..|...:::..|.|                     .|::.. :::|| |:..|:.  
Human   352 VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGL-LAEKDSNYCLCRT-- 413

  Fly   399 FKCLYDNRFTFSIERHPEEDDFVKNPFKESMICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTM 463
             .|        ::.|:.:|...||.|.|        ||...|  ::.|     :.:|.......:
Human   414 -PC--------NLTRYNKELSMVKIPSK--------TSAKYL--EKKF-----NKSEKYISENIL 454

  Fly   464 RLDIFYQSGWFIQYQT---NMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIGLYLYIHGK 525
            .||||:::   :.|:|   ...:....||...||.:|||:|||:|:..||   |.   |:|...|
Human   455 VLDIFFEA---LNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILEL---FD---YIYELIK 510

  Fly   526 RKL 528
            .||
Human   511 EKL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 108/522 (21%)
ASIC2NP_899233.1 ENaC 64..547 CDD:273304 114/535 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.