DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ppk27

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_647826.2 Gene:ppk27 / 38440 FlyBaseID:FBgn0035458 Length:422 Species:Drosophila melanogaster


Alignment Length:510 Identity:101/510 - (19%)
Similarity:188/510 - (36%) Gaps:129/510 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DYAAESSVHGIRYLADPKMRNYLNIRVIWLLILLTTSIGAIVV-YVDLNELYQTVRIQTTIKNTM 113
            :|..::|::|...|...:.|...  |:.|.|.:   |.|.:.. |...:.:.:.:...|....:.
  Fly    14 EYFRKTSLNGFGLLYFIRKRRIQ--RIFWFLFI---SFGILFASYAVFSMVLEFLSYSTIADLSE 73

  Fly   114 LPIF--RIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEM 176
            |.:.  .|.||.:.:|...:.:::.:...|.|     .||:..|.|         |..|::|:.:
  Fly    74 LKVLEDEIHFPELKICSGYKFSYRNMLASAHD-----LVSSQNKSL---------DYWLNKLSLL 124

  Fly   177 SNFFGNKTL----TDELHMLDHLDLREVYKFIQF---RCQDLFHTCRWRGNPVNCCEVIEYQ-FT 233
            |.:|...::    .|:|:.|  ||::.:..|:..   .|:.|...|:....|.||.::...: :.
  Fly   125 SGYFDALSVKAENVDDLNSL--LDIKNISSFLLALTPACESLILKCKLNNIPANCLKLFTLKAYN 187

  Fly   234 EAGLCFVFNTEIS---PASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRPGKRGINVMIK 295
            :...|.:.|:.::   ......::.|:|     |..|...|..|                     
  Fly   188 DGNCCVLRNSNLTGELTLFMDSSQIDEY-----PLNGNLPGFSL--------------------- 226

  Fly   296 QPQQWSDVVRHVPHEAHTRISITPRFTVTDE----------RTRTVTPEIRRCIFGDEVDNPHYK 350
                      ||| ....|:||.|......|          :......|.|.|.|..|.::..  
  Fly   227 ----------HVP-SWQGRVSINPGEMAAVEIEVMELQGNSQLNEYAVEKRACYFSQEGESRE-- 278

  Fly   351 NFPDFEYWVGNCRSRCHQEHVLNLCKCSPSIFFPISDK-DNFTACKASDFKCLYDNRFTFSIERH 414
                      .|...|..:..|..|:|.|   :|...: ..|..|...:.:||            
  Fly   279 ----------KCLHECRIKATLINCQCVP---YPFEFRTQKFGYCTLENIRCL------------ 318

  Fly   415 PEEDDFVKNPFKESMICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTMR--LDIFYQSGWFIQY 477
                ..|:..:..:....|...|:|| |.|:       |.:........|  |:..:::....:|
  Fly   319 ----QLVERNWSPAQCPQCLPLCNQL-FYRL-------NKQILGHLHPWRSELNFKFKTPHRQRY 371

  Fly   478 QTNMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIGLYLYIHGKRKLRKPE 532
            :||:.:.:.::|::.||::|:.:|.|.:|.|||.|:....|:     ...||:||
  Fly   372 KTNILYHWYQMLSNVGGVLGICIGCSFISGFELIYFLVFRLW-----TNYLRQPE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 95/488 (19%)
ppk27NP_647826.2 ASC 15..407 CDD:279230 95/488 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.