DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and Gr59e

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:98 Identity:24/98 - (24%)
Similarity:39/98 - (39%) Gaps:32/98 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 GTMRLDIFYQSGWFIQYQT---------NMRFT--FVELLAS-FGGIIGLFLGASLLSAF----- 508
            |:.:||..|:|.:.:....         .||:|  .:|.:.| |....||:|..:||::.     
  Fly   201 GSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNLLNSLVSICV 265

  Fly   509 ELAYYFSIG---------------LYLYIHGKR 526
            ||...|:..               |:|.:||.|
  Fly   266 ELYLIFNFFETPLWEESVLLVYRLLWLAMHGGR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 18/68 (26%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.