DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ppk12

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster


Alignment Length:543 Identity:110/543 - (20%)
Similarity:202/543 - (37%) Gaps:115/543 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RKNSRLGKLWHFMLPYLKDYAAESSVHGIRYLADPKM----RNYLNIRVIWLLILLTTSIGAIVV 92
            |:.|.|..|..|:.. |:.:..::|:||::::.|..:    |::.....:..||:....|..|.|
  Fly    11 RQGSSLFLLKSFVRS-LRQFLNQTSLHGLKFVGDSGLSSWERSFFLGSFVTALIITVHLISNIYV 74

  Fly    93 YVDLNELYQTVRIQTTIKNTMLPIFRIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDL 157
            ..|...:...:..|.|      .|.::|||:|.:|..|::...::    .::..|:|.||     
  Fly    75 KWDSTPVIIGISPQAT------SILKVPFPAITICNMNQVQRSLV----ANYREGSNESA----- 124

  Fly   158 FVKFFTAAGDPHLSRLNE---MSNFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRG 219
            .:|....:.....|..:|   .|||..|           :|.:.|........|:.:...||:..
  Fly   125 LLKLLCESDSWESSEADEEFSASNFVTN-----------NLKISEFVSNHSQSCERMLLFCRFSA 178

  Fly   220 NPVNCCEVIEYQFTEAGLCFVFNTE--------ISPASRQKARED-------------------K 257
            ...||.::.:...|:.|||.|||.:        .:..:|.....|                   |
  Fly   179 VERNCSQLFQQILTDEGLCCVFNFQPPEYLYKPFANNNRNLTNSDGFESVMWDPESGYPEQLPPK 243

  Fly   258 YYPLRTPHYGEGSGLDLFLRLN------RSFIRPG-KRGINVMIKQPQ-QWSDVVRHVPHEAHTR 314
            :||......|...|....|...      .|...|| |...:..|:.|: :.:.::..:.:|.:.|
  Fly   244 FYPATASGTGITLGFTAVLDAEMGEYYCSSTNGPGFKVYFHNPIEVPKVKEAGLISAIGYETNYR 308

  Fly   315 ISITPRFTVTDERTRTVTPEIRRCIFGDEVDNPHYKNFPDFEYWVGNCRSRCHQEHVLNLCKC-- 377
            |.:.....|  ...|:::.:.|:|:|.:|.:...|:.:...     ||.:.|....:.:.|.|  
  Fly   309 IEMVRAEAV--PAIRSISRDGRQCLFKNEKELIFYRIYTRL-----NCENECLAAFLYDTCSCIP 366

  Fly   378 --SPSIFFPISDKDNFTACKASDFKCLYDNRFTFSIERHPEEDDFVKNPFKESMIC--DCFTSC- 437
              .|.|:      .|.:.|...|..|:.      ..:|......:.|        |  .|..|| 
  Fly   367 FDHPLIY------SNASICSMGDTSCVR------RAQRASNRPGWAK--------CRQQCLPSCF 411

  Fly   438 ------SQLVFDRVFTTTTLDN------NETDTEAGTMRLDIFYQSGWFIQYQTNMRFTFVELLA 490
                  |...|........|.|      |::........::::::...:.....|......|.|:
  Fly   412 DLNYLASGFSFPLASNNFQLANALVESFNKSYLSKNIAVINVYFRESVYYGNTKNAYVGLTEFLS 476

  Fly   491 SFGGIIGLFLGASLLSAFELAYY 513
            :.||::|||:|.|::|..|:.|:
  Fly   477 NVGGVMGLFMGFSVISLAEILYF 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 103/522 (20%)
ppk12NP_611672.1 deg-1 28..499 CDD:273309 103/523 (20%)
ASC 29..499 CDD:279230 103/522 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112386at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.