DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and Nach

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster


Alignment Length:521 Identity:116/521 - (22%)
Similarity:222/521 - (42%) Gaps:85/521 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YLK----DYAAESSVHGIRYLADPKMRNYLNIRVIWLLILLTTSIGAIVV----YVDLNELYQTV 103
            ||:    |:.|.||:||::|..|......  :.::||||.:...|.|:|:    |:|    |::.
  Fly    22 YLRRTWSDFCATSSIHGLKYTRDEDTNKI--VHLVWLLISVVMFICAVVMARTFYMD----YRSS 80

  Fly   104 RIQTTIKNTMLPIFRIPFPSIGLCPRNRLNWKILETEAVDHFL----GANVSAAQKDLFVKFFTA 164
            ..:..:::...|:.|:.||.:.:||....|.:  ::||..:.|    ||.:....:.|.:.:...
  Fly    81 PTRMNVESDNTPVNRLYFPPVTICPDVLFNMQ--KSEAFLNTLRLPKGAELRGILRKLHIFYGFM 143

  Fly   165 AGDPHLSR--LNEMSNFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEV 227
            ..|...|.  :.:|          :.|..|::|.:.|..:.:::.|.::.:.||:.|..::|.::
  Fly   144 LDDERYSAEDIEQM----------EALLFLNNLTIPEFVEHLRWNCDEILYRCRFNGEIMDCSKI 198

  Fly   228 IEYQFTEAGLCFVFNTEISPASRQKA---------REDKYYPLRTPHY-------GEGSGLDLFL 276
            .:...|..|.|..||.      |||.         ...|.:.|.:.::       |...||.:.:
  Fly   199 FQLSKTFFGHCCSFNL------RQKGWVNNKLNNLESFKVFHLNSLNFTAQRAIGGLRYGLSVVV 257

  Fly   277 RL---NRSFIRPGKRGINVMIKQPQQW---SDVVRHVPHEAHTRISITPRFTVTDERTRTVTPEI 335
            |.   |...::....|:.::|::...:   ....:.:...:.|..::.|:.|......:.:..|.
  Fly   258 RYKDDNYDPLQSYSYGVKLLIQEADAFPSAHSAAKFIAFNSETFAAVRPQETFCSSAVKALIIEE 322

  Fly   336 RRCIFGDEVDNPHYKNFPDFEYWVGNCRSRCHQEHVLNLCKCSPSIFFPI---SDKDNFTACKAS 397
            |.|:|.:|..   .:.|.|:.|  .||...|...:::..|.|. :.||..   ||:    .|...
  Fly   323 RNCVFQNEFP---MRYFSDYVY--PNCELNCRVTNMVKFCGCH-TYFFDFNRTSDR----ICTFR 377

  Fly   398 DFKCLYDN--RFTFSIERHPEEDDFVKNPF---KESMICDCFTSCSQLVFDRVFTTTTLDNNETD 457
            |..||.||  |......::.:.:..:....   |:|..|.|..:|..:.:|...|...|:.|...
  Fly   378 DIPCLVDNFGRLLLICSKYSDFNRLLSANIITRKKSTQCYCPLTCEHIDYDVQLTNFPLELNMPV 442

  Fly   458 TE---AGTMR----LDIFYQSGWFIQYQTNMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFS 515
            .:   :|..:    |.:|..|..:.:.:.::....|.|:::.|....||:|.|:||..|:.||||
  Fly   443 ADKFYSGLAKNDGVLHVFINSFSYRRLRRDLLSNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYFS 507

  Fly   516 I 516
            :
  Fly   508 V 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 109/508 (21%)
NachNP_001334724.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I4697
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112386at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.