DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and egas-4

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:399 Identity:84/399 - (21%)
Similarity:142/399 - (35%) Gaps:91/399 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GDPHLSRLNEMSNFFGN-KTLTDEL--HMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNC-CE 226
            ||....:|:||:....| .||..::  .::....| ||...:.:...|:|....:....::. ..
 Worm   537 GDLGPDKLDEMAQELTNDPTLVRDIVPFLIGGYSL-EVRTSLSWTAADMFLWVAYEQQLIDLNSN 600

  Fly   227 VIEYQFTEAGLCFVFNTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRPGKRGIN 291
            .:::.....|.||.|| .::.:.:.:||...|          ..||::.:.:.:....|......
 Worm   601 FVQWNDKVLGNCFTFN-HMNSSFKYEARSSGY----------PGGLEMQMNVKQDEYLPWTETAG 654

  Fly   292 VMI----KQPQQWSDVVR--HVPHEAHTRISIT--------PRFTVTDERTRTVTPEIRRCIFG- 341
            ||:    |:....|:.||  ..|| ..:||:|.        .|:.|              ||.. 
 Worm   655 VMVFTSTKEEAVTSESVRINTAPH-FESRIAINRVDYYRLGGRYGV--------------CINSV 704

  Fly   342 DEVDNPHYKNFPDFEYWVGNCRSRCHQEHVLNLCKC-SPSIFFPISDKDNFTACKASDFKC---L 402
            .||.:.:|    |.:|....|...|:|:.|...|.| .|....|    ::..:|..|...|   |
 Worm   705 SEVKSYYY----DGDYTTDGCLRSCYQDVVNGDCGCMDPRYPMP----NDGISCSISQKTCIDEL 761

  Fly   403 YDNRFTFSIERHPEEDDFVKNPFKESMICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTMRLDI 467
            .|:|...|  ..||              |.|...|||.|:....:.....|...|.|........
 Worm   762 VDSRGDPS--TWPE--------------CTCPLPCSQTVYTSKLSRLPYVNKIVDCEEAYTNKTA 810

  Fly   468 FYQSGWFIQ---------------YQTNMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIG 517
            .|::  |:.               |.........:.::..|||:.:.:|.|::|..||.:.|...
 Worm   811 CYET--FLDSVILRISLPKLDYMIYSETPAMDLTKFMSYLGGILSILIGVSIVSFVELFFLFVQL 873

  Fly   518 LYLYIHGKR 526
            :.:.:..||
 Worm   874 IVILLFNKR 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 81/384 (21%)
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230 68/310 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.