DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ppk11

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001334672.1 Gene:ppk11 / 34299 FlyBaseID:FBgn0065109 Length:516 Species:Drosophila melanogaster


Alignment Length:488 Identity:97/488 - (19%)
Similarity:177/488 - (36%) Gaps:129/488 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YAAESSVHGIRYLADPKMRNYLNIRVIWLLIL---LTTSIGAIVVYVDLNELYQTVRIQTTIKNT 112
            |...:|:||.......|...    |::|.|::   :..|...:::.:.:::...|:|.   |...
  Fly    96 YCEMASIHGFHIFVGAKTWQ----RILWWLLICNAVLLSFTLVIMSLSMSKETPTIRF---IDTM 153

  Fly   113 MLPIFRIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEMS 177
            |.|...:|||::.:|..|...|                                      :|  |
  Fly   154 MKPTAEVPFPAVTICGFNTKEW--------------------------------------MN--S 178

  Fly   178 NFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIEYQFT-EAGLC--F 239
            :...|:.....|.:|:.|.|.        .|..: ..|:|....|||.:.::..:| :..||  |
  Fly   179 SQIVNQRNASWLELLEDLALP--------ICPQI-KICQWDNRMVNCLDQLQPIWTLDQRLCCSF 234

  Fly   240 VFNTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRPGK-RGINVMIKQPQQWSDV 303
            .:|.::                    :....|:...||.|...::..| .|..|:|.:..:..:.
  Fly   235 NYNKQL--------------------FSSYLGVSFVLRSNDEILQSSKSAGFEVLIHESHEIPNG 279

  Fly   304 VR---HVPHEAHTRISITP---RFTVTDERTRTVTPEIRRCIFGDE---VDNPHYKNFPDFEYWV 359
            ..   .||.|:...|.:.|   |||   :..:.::.:.|.|.|..|   :.:..|...       
  Fly   280 ATPRVFVPGESDAHIMLRPYINRFT---KNLKGLSLQKRGCYFSTERRLILSDVYNQI------- 334

  Fly   360 GNCRSRCHQEHVLNLCKCSPSIFFPISD-KDNFTACKASDFKCLYDNRFTFSIERHPEEDDFVKN 423
             ||.:.|..|.:|..|.|.|    |.|. :.::..|.....:|:.|.          :.|:.:..
  Fly   335 -NCLAECRTESILKSCGCIP----PKSPIEKSWLICDLKQMQCVIDF----------DHDEIISG 384

  Fly   424 PFKESMICDCFTSC--------SQLVFDRVFTTTTLDNNETDTEAGTMRLDIFYQSGWFIQYQTN 480
               |...|||...|        |.:.|.:.....::.|.........:|:.::|.|....:...:
  Fly   385 ---EQKNCDCLPPCEFNRYEFQSDIRFIKGMINNSIVNTSNQETTNEVRVRVYYDSAIAEELLLD 446

  Fly   481 MRFTFVELLASFGGIIGLFLGASLLSAFELAYY 513
            :...::..:.:||||.|||:|.|.:|.|||.::
  Fly   447 VYENWLTFIGTFGGITGLFMGCSFVSVFELIFF 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 97/486 (20%)
ppk11NP_001334672.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.