DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and ppk23

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:548 Identity:142/548 - (25%)
Similarity:222/548 - (40%) Gaps:110/548 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KDYAAESSVHGIRYLAD---PKMRNYLNIRVIWLLILLTTSIGAIVVYVDLNELYQTVRIQTTIK 110
            |::...|::||:||:|:   |     :..:.:|...   |||||:...|.:..|::..:...||.
  Fly    32 KEFFQNSTLHGVRYIAESGRP-----IGEKFMWFCF---TSIGAVTALVIIMSLWEKFQTNPTIT 88

  Fly   111 --NTMLPIFRIPFPSIGLCP-----RNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDP 168
              :|......:.||:..:||     .::...|:..|.       ||...||..::..|...    
  Fly    89 GLDTDFHNQNVVFPTTVVCPEAAFDHDKTYEKVYNTL-------ANYDEAQAQMYTPFLRI---- 142

  Fly   169 HLSRLNEMSNFFGNKTLTDEL--HMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIEYQ 231
             |:.|| ..|....|.|:..:  ::||...:||........|:::|.:|::|...:.||:..|..
  Fly   143 -LTSLN-FENVRDAKVLSQSIPQNLLDAHTIREWAFEGHIDCKNVFVSCKYRDEDIPCCDHFEPI 205

  Fly   232 FTEAGLCFVFNTEISPASRQKAREDKYYPLRTPH--YGEGSGLDLFLRLN---RSFIRPGKRGIN 291
            :||.|.|:.||      ||.|:...:......||  |.......||...|   |.||...:....
  Fly   206 YTEHGFCYAFN------SRFKSTPTEDVKTGAPHDLYETDKKWALFFIPNSTSRIFIFSNEEYFG 264

  Fly   292 VMIKQPQQWSDVVRHVPHEAHTRISITPRFTVTDERTRTVTPEIRRCIFGDEVDNPHYKNFPDFE 356
            ........||:     |.....|||....:|..|.|..::..  |:|||.|||   ....||| .
  Fly   265 SDFNAQIDWSE-----PQLVEVRISKKNTYTTDDARQLSIGQ--RKCIFSDEV---KLNYFPD-A 318

  Fly   357 YWVGNCRSRCHQEHVLNLCKCSPSIFFPISD----------------------KDNFTACKASDF 399
            |...:|..:|.....:.||||:|..:.||.:                      |.|...|...||
  Fly   319 YTFSSCMKQCRMNKAIKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPKANVPMCSIKDF 383

  Fly   400 KCLYDNRFTFSIERHPEEDDFVKNPFKESMICDCFTSCSQLVF--DRVFTTTTLDNNETDTEAGT 462
            .||               |:|..|.........|..|||:.||  |::...:  |..|:   .|.
  Fly   384 DCL---------------DEFKSNITNIKDCLQCELSCSKTVFNIDKLIKMS--DRPES---LGV 428

  Fly   463 MRLDIFYQSGWFIQYQTNMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIGLYLYIHGKR- 526
            :   :.:.:...|:|:..:.|.:|:||.|||||..||||.||||..|:.|||::.....::..| 
  Fly   429 L---VEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIYYFTLRACCMVYKNRQ 490

  Fly   527 -------KLRKPEPGVLTIQFGQRKITP 547
                   |:|:..|..:.::...:...|
  Fly   491 ELYEIEEKIRQEPPPKIDLKLSLKSHNP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 133/502 (26%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 133/502 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.