DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and Asic2

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_037024.2 Gene:Asic2 / 25364 RGDID:2017 Length:563 Species:Rattus norvegicus


Alignment Length:588 Identity:127/588 - (21%)
Similarity:214/588 - (36%) Gaps:166/588 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLELPRARRPLYRDYGGKSG--LIQTQRDARKNSRLGKLWHFMLPYLKDYAAESSVHGIRYLADP 66
            |:.:..||:|    .|.:||  .:|....||:..          |.|    :.:.:||:|::...
  Rat    29 PVAVAAARQP----GGDRSGDPALQGPGVARRGR----------PSL----SRTKLHGLRHMCAG 75

  Fly    67 KMR--NYLNIRVIWLLILLTTSIGAIVVYVDLNELY-----QTVRIQTTIKNTMLPIFRIPFPSI 124
            :..  .....|.:|:| ...||:|.::.:.....||     ...|:......      ::|||::
  Rat    76 RTAAGGSFQRRALWVL-AFCTSLGLLLSWSSNRLLYWLSFPSHTRVHREWSR------QLPFPAV 133

  Fly   125 GLCPRNRLNWKIL---ETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRLNEMSNFFGNKTLT 186
            .:|..|.|.:..|   :.....|:||..:........|.......:|......::::|   :...
  Rat   134 TVCNNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSELLRGDEPRRQWFRKLADF---RLFL 195

  Fly   187 DELH-------MLDHLDLREVYKFIQFRCQDLFHTCRWRG---NPVNCCEVIEYQFTEAGLCFVF 241
            ...|       .:|.|.         .:.:|:..:|::||   .|.|...|    ||:.|.|::|
  Rat   196 PPRHFEGISAAFMDRLG---------HQLEDMLLSCKYRGELCGPHNFSSV----FTKYGKCYMF 247

  Fly   242 NTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRP---------GKRGINVMIKQP 297
            |          :.||....|.|...|.|:||::.|.:.:....|         .:.|:.|.|...
  Rat   248 N----------SGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQ 302

  Fly   298 QQWSDVVRHVPHEAHTRISITP---RFTVTDERTRTVTP----EIRRCIFGDEVDNPHYKNFPDF 355
            .:       .|........:.|   .|..|.|:..|..|    |.|....|.:.       ||  
  Rat   303 SE-------PPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDF-------FP-- 351

  Fly   356 EYWVGNCRSRCHQEHVLNLCKC---------------------SPSIFFPISDKD-NFTACKASD 398
            .|.:..||..|...:::..|.|                     .|::.. :::|| |:..|:.  
  Rat   352 VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGL-LAEKDSNYCLCRT-- 413

  Fly   399 FKCLYDNRFTFSIERHPEEDDFVKNPFKESMICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTM 463
             .|        ::.|:.:|...||.|.|        ||...|  ::.|     :.:|.......:
  Rat   414 -PC--------NLTRYNKELSMVKIPSK--------TSAKYL--EKKF-----NKSEKYISENIL 454

  Fly   464 RLDIFYQSGWFIQYQT---NMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIGLYLYIHGK 525
            .||||:::   :.|:|   ...:....||...||.:|||:|||||:..||   |.   |:|...|
  Rat   455 VLDIFFEA---LNYETIEQKKAYEVAALLGDIGGQMGLFIGASLLTILEL---FD---YIYELIK 510

  Fly   526 RKL 528
            .||
  Rat   511 EKL 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 109/522 (21%)
Asic2NP_037024.2 ENaC 64..557 CDD:273304 115/535 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.