DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and egas-3

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:377 Identity:78/377 - (20%)
Similarity:137/377 - (36%) Gaps:81/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 SRLNEMSNFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDL-----FHTCRWRGNPVNCCEVIEY 230
            |::.:|..|. ...|||........|..:::.:|.|..|.|     .|  :|.       :|:  
 Worm   595 SQIKDMVPFI-TGLLTDSERSDLSWDAGDLFNWIAFEDQRLDLNRDIH--KWN-------DVV-- 647

  Fly   231 QFTEAGLCFVFNTEISPASRQKAREDKY-YPLRTPHYGEGSGLDLFLRLNRSFIRP--GKRGINV 292
                .|.||.||          .|:..: |.:|.|  |...|:..|::..:....|  ....|||
 Worm   648 ----LGNCFTFN----------HRDRNFTYLMRRP--GRHGGIQAFMKTRQDEYAPWYDTAAINV 696

  Fly   293 MI--KQPQQWSDVVRH-VPHEAHTRISI-TPRFTVTDERTRTVTPEIRRCI-FGDEVDNPHYKNF 352
            .|  :....:|:.||: ....|.:.|:| ..|:|       .:.....:|| ...||.|.:|.. 
 Worm   697 FIHNRDDYVFSESVRYNAQPNAQSTINIFMTRYT-------RLGGNYGKCIKKPSEVKNYYYPG- 753

  Fly   353 PDFEYWVGNCRSRCHQEHVLNLCKCSPSIFFPISDKDNFTACKASDFKCLYDNRFTFSIERHPEE 417
               .|....|...|:|:.:...|.|....:   ....|.|:|:.|:..|:            .|.
 Worm   754 ---AYTTDGCLRTCYQDRMKEECNCMDPRY---PQAPNSTSCQLSERSCV------------TEA 800

  Fly   418 DDFVKNPFKESMICDCFTSCSQLVFDRVFTTTTLDN----NETDTEAGT--------MRLDIFYQ 470
            .:...:|...|. |.|...||...:...::.....|    .|..::..|        :.:.|...
 Worm   801 SEAAGDPSTWSS-CVCPLPCSNQEYSVTWSKANFVNLPITCEKSSDVATCQKQYKDQLMVSIILP 864

  Fly   471 SGWFIQYQTNMRFTFVELLASFGGIIGLFLGASLLSAFELAYYFSIGLYLYI 522
            ...|..|.......|.:.|:..||.:|:.:|.::::..|:.:.| .|:::.:
 Worm   865 QLDFKIYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVFLF-FGMFMVL 915

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 76/366 (21%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 62/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.