DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and degt-1

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:453 Identity:96/453 - (21%)
Similarity:157/453 - (34%) Gaps:128/453 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LPYLKDYAAESSVHGIRYLADPKMRNYLNIRVIWLLILLTTSIGAIVVYVDLNELYQTVRIQT-- 107
            :|.|..:|.::|:.|.|||   ..|.....||:|         |.:||:......||.....|  
 Worm    38 IPALDRFAEDTSMLGFRYL---HTRYKTWFRVLW---------GFVVVFFIGLTFYQVFERVTYY 90

  Fly   108 TIKNTM--------LPIFRIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTA 164
            .|||.:        ||  .:.||:||:|  |::..|           .::|::...||....   
 Worm    91 FIKNPLTTRRSYETLP--NMYFPTIGVC--NKMQIK-----------ASSVASKNPDLLRGM--- 137

  Fly   165 AGDPHLSRLNEMSNFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIE 229
                 .|.|:|.|:   |.:..|||...|.:|:..:|:.......|||.:|.: |...:|.:.|.
 Worm   138 -----CSVLDESSS---NSSRFDELDKFDDVDILSLYRNSFQSADDLFVSCEF-GKSGSCQDEIR 193

  Fly   230 YQFTEAGLCFVFNTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRPG---KRGIN 291
            ..:|..|||:    .:||..          .:..|  |..:.|.|.|.|....|.||   :.|:.
 Worm   194 PIYTPFGLCY----SVSPNK----------TILRP--GPETTLSLVLNLEVHEIIPGTVVEPGVV 242

  Fly   292 VMIKQPQQWSDVVRHVPHEAHTRISITPRFTVTDERTRTVT---PEIRRC-IFGDEVDNPHYKNF 352
            :.|   ...:..:.|.....|.            |..:.||   .|:|:. :......:...::|
 Worm   243 LSI---YDGASSLSHYSEGIHL------------EAGKVVTIPVNEVRKLRLHESSCGSTKMESF 292

  Fly   353 PDFEYWVGNCRSRCHQEHVLNLCKCSP-------SIFFPISD-----------------KDNFTA 393
            .:.||....|......:.:...|.|.|       .:|...:|                 |.|...
 Worm   293 SEKEYSKAACEWSVSVKQIEKECGCIPIRNPIYRGVFDNKNDPLNNSTEIPKKKYKKWKKRNIPR 357

  Fly   394 CK-ASDFKCLYDNRFTFSIERHPEEDDFVKNPFKESMICDCFTSCSQLVFDRVFTTTTLDNNE 455
            |. ..:.:|:.:     .:...|..||.:           |...|..:.|..:.....|.::|
 Worm   358 CTLRQEIECVQE-----KLNIRPHIDDSI-----------CPDDCDDISFSSIVFGGKLSSSE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 94/447 (21%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 78/343 (23%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.