DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and del-9

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_508622.2 Gene:del-9 / 182767 WormBaseID:WBGene00015957 Length:579 Species:Caenorhabditis elegans


Alignment Length:511 Identity:99/511 - (19%)
Similarity:175/511 - (34%) Gaps:147/511 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SSVHGIRYLADPKMRNYLNIRVIWLLILLTTSIGAIVVYVDLNELYQTVRIQTTIKNTMLPIF-- 117
            |::||:|   |..:.:...:|::|:||::      :.:::.....|| :..:.:::..::..|  
 Worm    87 STLHGLR---DVMLSSSGRLRMVWVLIVI------LALFMTFQGCYQ-IMDEYSMRRIVVSYFIQ 141

  Fly   118 ---RIPFPSIGLCPRNRLNWKILETEAVDHFLG--------------ANVSAAQKDLFVKFFTAA 165
               .|..|.:.:||.||||...:|...|...|.              .|:...|:::..|..|. 
 Worm   142 EAQSIWVPDVVVCPYNRLNRSFIEANNVSFELAQFLELSFPSMDLPFENIQQQQEEIISKIDTL- 205

  Fly   166 GDPHLSRLNEMSNFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIEY 230
             |..:..|.|.:|                :...:..:.....|:..|...|      .|....|.
 Worm   206 -DFQIEILLEQNN----------------MTYAQFLRKASLNCEAFFEDSR------RCANTTEI 247

  Fly   231 QFTEAGLCFVFNTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRPGKRGINVMIK 295
             .|.||.||                 :...::....|.|:|....:.|...:..|   |||.||.
 Worm   248 -MTSAGKCF-----------------RMAGIKQEIAGFGNGDRYVIDLPEEYYNP---GINQMIN 291

  Fly   296 QPQQWSDVVRHVPHEAHTRISITPRFTVTDERTRTVTPEIRRCIFGDEV----DNPHY--KNFPD 354
                 |.|:..:.....   .|....|........:.|     :.|.:.    |.|.|  :..|.
 Worm   292 -----SGVIIKLAERGQ---GIDNDLTFLPAGVHAIMP-----LLGTQFEFMNDPPRYECEEDPH 343

  Fly   355 FEYWVGNCRSRCHQEHVLNLCKCSPSI----FFPISDKDNFTACKASD-FKCLYDNRFTFSIERH 414
            ..|...:|...|........|:|||:.    .:|  ||    .|.|:. :.|.:...|       
 Worm   344 GNYSRVHCFEDCLTLDAQQTCQCSPAAAQNPAYP--DK----LCTATQLYHCFFTKLF------- 395

  Fly   415 PEEDDFVKNPFKESMICDCFTSC----------SQLVFDRVFTTTT---LDNNETDTEAGTMRLD 466
            ||:.:..|     :::..|...|          .|:.:..:.:..:   |...|.:.....:.||
 Worm   396 PEDSNLSK-----AIVDACKKECKAPCHAWNYNKQVSYSSIPSEASKKLLPREEWEKMKRKIILD 455

  Fly   467 IFYQSGWFIQYQTNMRFTFVE---------LLASFGGIIGLFLGASLLSAFELAYY 513
            |:|         :.:.:|.::         |:|..||...||.|.||:|..::..|
 Worm   456 IYY---------SELDYTIIKHVIAMPLSSLIAQIGGQFSLFAGGSLISLCQIVIY 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 98/509 (19%)
del-9NP_508622.2 ASC 85..502 CDD:307141 98/509 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.