DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and Asic1

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:NP_001276720.1 Gene:Asic1 / 11419 MGIID:1194915 Length:559 Species:Mus musculus


Alignment Length:481 Identity:96/481 - (19%)
Similarity:156/481 - (32%) Gaps:174/481 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGD--------PHLSRLNEMSN------ 178
            ||..| |.:....|    |||            |....||        ||::.|:|::.      
Mouse    86 PRQAL-WAVAFVIA----LGA------------FLCQVGDRVAYYLSYPHVTLLDEVATTELVFP 133

  Fly   179 --FFGNK--------TLTDELHMLDHLDLRE----------------------VYKFIQFRC--- 208
              .|.|.        :..|.|::...|.|.|                      :::|....|   
Mouse   134 AVTFCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFSGEPFNLHRFYNRSCHRL 198

  Fly   209 QDLFHTCRWRGNPVNCCEVIEYQ--FTEAGLCFVFNTEISPASRQKAREDKYYPLRTPHYGEGSG 271
            :|:...|.:.|.|   |....:.  ||..|.|:.||      |.|..|.    .|:|...|.|:|
Mouse   199 EDMLLYCSYCGGP---CGPHNFSVVFTRYGKCYTFN------SGQDGRP----RLKTMKGGTGNG 250

  Fly   272 LDLFLRLNRSFIRP---------GKRGINVMIKQPQQWSDVVRHVPHEAHTRISITPRFTVTDER 327
            |::.|.:.:....|         .:.||.|.|....:       .|........:.|.|..    
Mouse   251 LEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDE-------PPFIDQLGFGVAPGFQT---- 304

  Fly   328 TRTVTPEIRRCIF---------GDEVDNPHYKNFPDFEYWVGNCRSRCHQEHVLNLCKC------ 377
              .|:.:.:|.|:         ...:|:..:.:     |.:..||..|...:::..|.|      
Mouse   305 --FVSCQEQRLIYLPSPWGTCNAVTMDSDFFDS-----YSITACRIDCETRYLVENCNCRMVHMP 362

  Fly   378 ---------------SPSIFFPISDKDNFTACKASDFKCLYDNRFTFSIERHPEEDDFVKNPFKE 427
                           .|::.|.:.....:..|   :..|        ::.|:.:|...||.|.|.
Mouse   363 GDAPYCTPEQYKECADPALDFLVEKDQEYCVC---EMPC--------NLTRYGKELSMVKIPSKA 416

  Fly   428 S--MICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTMRLDIFYQSGWFIQYQT---NMRFTFVE 487
            |  .:...|....|.:.:.:..                 ||||::   .:.|:|   ...:....
Mouse   417 SAKYLAKKFNKSEQYIGENILV-----------------LDIFFE---VLNYETIEQKKAYEIAG 461

  Fly   488 LLASFGGIIGLFLGASLLSAFELAYY 513
            ||...||.:|||:|||:|:..||..|
Mouse   462 LLGDIGGQMGLFIGASILTVLELFDY 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 95/479 (20%)
Asic1NP_001276720.1 ASC 63..541 CDD:295594 96/481 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.