DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk21 and asic1

DIOPT Version :9

Sequence 1:NP_651704.2 Gene:ppk21 / 43485 FlyBaseID:FBgn0039675 Length:550 Species:Drosophila melanogaster
Sequence 2:XP_004912018.1 Gene:asic1 / 100489966 XenbaseID:XB-GENE-977699 Length:525 Species:Xenopus tropicalis


Alignment Length:507 Identity:108/507 - (21%)
Similarity:187/507 - (36%) Gaps:117/507 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YAAESSVHGIRYLADPKMRNYLNIRVIWLL-------ILLTTSIGAIVVYVDLNELYQTVRIQTT 108
            :|:.|::||:.::.  ....:...|:||:|       :||......|:.|.:...:.:...|.|.
 Frog    20 FASGSTLHGLAHIF--TYERFSCRRLIWVLCFLGSLSLLLYVCTERIIYYFEYPHVTKLDEISTP 82

  Fly   109 IKNTMLPIFRIPFPSIGLCPRNRLNWKILETEAVDHFLGANVSAAQKDLFVKFFTAAGDPHLSRL 173
                     |:.||::..|..|...:..:....:.| .|..:|.......:.....|.:..:..|
 Frog    83 ---------RMIFPAVTFCNLNEFRFSRVTKNDLYH-AGELLSLLNNRYELPDSQLADEKVMEIL 137

  Fly   174 NEMSNFFGNKTLTDELHMLDHLDLREVYKFIQFRCQDLFHTCRWRGNPVNCCEVIEY--QFTEAG 236
            .:.:||...|.        ...::||.|.......:::..:|::||..   |.|.::  .||..|
 Frog   138 QDKANFRNFKP--------KPFNMREFYDRTGHDIREMLLSCKYRGEE---CSVDDFVPVFTRYG 191

  Fly   237 LCFVFNTEISPASRQKAREDKYYPLRTPHYGEGSGLDLFLRLNRSFIRP---------GKRGINV 292
            .|:.||      |.:..|.    ||.|...|.|:||:|.|.:.:....|         .:.||.|
 Frog   192 KCYTFN------SGRNGRS----PLVTTKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKV 246

  Fly   293 MIKQPQQWSDVVRHVPHEAHTRISITPRF----TVTDERTRTVTPEIRRCIFGDEVDNPHYKNFP 353
            .|....:       .|........:.|.|    :..::|...:.|.     :||...:.....|.
 Frog   247 QIHSQDE-------PPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPP-----WGDCKSSAMDSEFF 299

  Fly   354 DFEYWVGNCRSRCHQEHVLNLCK------------CSPSIFFPISDKDNFTACKASDFKCLYDNR 406
            | .|.:..||..|...:::..|.            |:|.::...:|       .|.||....||.
 Frog   300 D-TYSISACRIDCETRYLVENCNCRMVHMPGDAAYCTPELYKECAD-------PALDFLVEKDND 356

  Fly   407 FTF-----SIERHPEEDDFVKNPFKES--MICDCFTSCSQLVFDRVFTTTTLDNNETDTEAGTMR 464
            |..     ::.|:.:|...||.|.|.|  .:...:....|.:.:.:..                 
 Frog   357 FCVCETPCNMTRYGKELSMVKIPSKASARYLAKKYNKSEQYIAENILV----------------- 404

  Fly   465 LDIFYQSGWFIQYQT---NMRFTFVELLASFGGIIGLFLGASLLSAFELAYY 513
            ||||:::   :.|:|   ...:....||...||.:|||:|||:|:..||..|
 Frog   405 LDIFFEA---LNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDY 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk21NP_651704.2 ASC 51..513 CDD:279230 107/505 (21%)
asic1XP_004912018.1 ASC 18..507 CDD:413546 108/507 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.