DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R2 and ADRA1D

DIOPT Version :9

Sequence 1:NP_001263072.1 Gene:Dop1R2 / 43484 FlyBaseID:FBgn0266137 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_000669.1 Gene:ADRA1D / 146 HGNCID:280 Length:572 Species:Homo sapiens


Alignment Length:395 Identity:159/395 - (40%)
Similarity:212/395 - (53%) Gaps:67/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 VGLLAFLFLFSFATVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLEN 173
            ||:..||..|....|.||.||||:|...|:|.|.|||||.:|||||.|:...|:||||..||| .
Human    97 VGVGVFLAAFILMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVL-G 160

  Fly   174 TWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSS 238
            .|.||..:||:|.::|||..|||||:||.||:|||..:.....||..||.::||.::|.:|:.:.
Human   161 FWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVAL 225

  Fly   239 AISFPAIVWWRAARDGEMPAYK--CTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTR 301
            .:|...::.|:.    .:|..:  |..||..||.||||..|||||:.|:|..|||:|..|...||
Human   226 VVSVGPLLGWKE----PVPPDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTR 286

  Fly   302 SLKIGTKQVLMASGELQLTLRIH-RGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHH 365
            ||:.|.|:....:.|  :.|||| ||..|                |..|...:..:..|:...  
Human   287 SLEAGVKRERGKASE--VVLRIHCRGAAT----------------GADGAHGMRSAKGHTFRS-- 331

  Fly   366 NHGGGTTTSTPEEPDDEPLSALHNNGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFII 430
                                                 |||.:|.||::||||||||.||:|||::
Human   332 -------------------------------------SLSVRLLKFSREKKAAKTLAIVVGVFVL 359

  Fly   431 CWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLL-CMCCP 494
            ||.|||.| |..|.....::..|.|..::.|||:.|||:||:||.|.||:|:|||:||| |.|..
Human   360 CWFPFFFV-LPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRR 423

  Fly   495 RKIRR 499
            |:.||
Human   424 RRRRR 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R2NP_001263072.1 7tm_4 123..>295 CDD:304433 82/173 (47%)
7tm_1 125..474 CDD:278431 136/351 (39%)
ADRA1DNP_000669.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
7tmA_alpha1D_AR 97..413 CDD:320450 149/378 (39%)
TM helix 1 98..124 CDD:320450 12/25 (48%)
TM helix 2 131..157 CDD:320450 16/25 (64%)
TM helix 3 169..199 CDD:320450 18/29 (62%)
TM helix 4 211..234 CDD:320450 5/22 (23%)
TM helix 5 251..280 CDD:320450 17/28 (61%)
TM helix 6 341..371 CDD:320450 20/30 (67%)
TM helix 7 381..406 CDD:320450 13/24 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..488
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BB8F
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001183
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X580
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.