DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1907 and DIC1

DIOPT Version :9

Sequence 1:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:111/332 - (33%)
Similarity:164/332 - (49%) Gaps:56/332 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSATSVQEAPKKAVATNAIKF--LFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHC 63
            ||..:.:.|.|.      ||:  .:||.:|:.||||..||||.|.|:|     :......:....
Yeast     1 MSTNAKESAGKN------IKYPWWYGGAAGIFATMVTHPLDLAKVRLQ-----AAPMPKPTLFRM 54

  Fly    64 IQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITD-------SMAM 121
            :::|::.||.:.||.|:.||:|||.||||.|.|.|    ||.:|.......:|:       ||..
Yeast    55 LESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAY----DLLKENVIPREQLTNMAYLLPCSMFS 115

  Fly   122 GTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITR-EEGLTALWRGSLPTVG 185
            |.|.|..|.|    |:|..:||.:|..|..|:||||.|..:.:.:|.| |.||..|:.|..|.:.
Yeast   116 GAIGGLAGNF----ADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMV 176

  Fly   186 RAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKL---------HFCASMLSGLLTTITSMPLDIAK 241
            |.:::..:|:.:|..||.|.         ..||         |..||:|:||:.|....|.|:.|
Yeast   177 RGILMTASQVVTYDVFKNYL---------VTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMK 232

  Fly   242 TRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNK 306
            |||.|     |..:::....:|....|:||...:::|:.|.:.||||.|:|.|..:|||    .|
Yeast   233 TRIMN-----GSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQL----KK 288

  Fly   307 YVLGSNK 313
            :.:|..|
Yeast   289 HRVGMPK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 37/94 (39%)
Mito_carr 118..207 CDD:278578 33/89 (37%)
Mito_carr 219..307 CDD:278578 31/87 (36%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 34/82 (41%)
Mito_carr 100..200 CDD:395101 34/112 (30%)
Mito_carr 203..289 CDD:395101 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.